Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 693227..693703 Replicon chromosome
Accession NZ_LT992462
Organism Staphylococcus aureus isolate 5_3949

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE65_RS03415 Protein ID WP_000052076.1
Coordinates 693515..693703 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE65_RS03410 Protein ID WP_001059690.1
Coordinates 693227..693487 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE65_RS03375 688625..689341 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
DXE65_RS03380 689489..689911 + 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE65_RS03385 690310..690804 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE65_RS03390 690953..691570 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE65_RS03395 691643..692224 - 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE65_RS03400 692449..692685 + 237 WP_000368687.1 hypothetical protein -
DXE65_RS03405 692682..692885 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE65_RS03410 693227..693487 + 261 WP_001059690.1 hypothetical protein Antitoxin
DXE65_RS03415 693515..693703 + 189 WP_000052076.1 hypothetical protein Toxin
DXE65_RS03420 693891..694460 + 570 WP_001106655.1 hypothetical protein -
DXE65_RS03425 694548..694832 + 285 WP_001004403.1 hypothetical protein -
DXE65_RS03430 694893..695111 + 219 WP_000005881.1 hypothetical protein -
DXE65_RS03435 695608..695808 - 201 WP_001059082.1 cold-shock protein -
DXE65_RS03440 696165..696851 - 687 WP_001574556.1 thermonuclease family protein -
DXE65_RS03445 697192..697674 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / scn / chp / sak / sea 690310..795503 105193


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294098 WP_000052076.1 NZ_LT992462:693515-693703 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294098 WP_001059690.1 NZ_LT992462:693227-693487 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References