Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1862139..1862615 Replicon chromosome
Accession NZ_LT992461
Organism Staphylococcus aureus isolate 8_LA_272

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE60_RS09840 Protein ID WP_000052076.1
Coordinates 1862139..1862327 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE60_RS09845 Protein ID WP_001059690.1
Coordinates 1862355..1862615 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE60_RS09810 1858168..1858650 + 483 WP_000824489.1 hypothetical protein -
DXE60_RS09815 1858991..1859677 + 687 WP_001574556.1 thermonuclease family protein -
DXE60_RS09820 1860034..1860234 + 201 WP_001059082.1 cold-shock protein -
DXE60_RS09825 1860731..1860949 - 219 WP_000005881.1 hypothetical protein -
DXE60_RS09830 1861010..1861294 - 285 WP_001004403.1 hypothetical protein -
DXE60_RS09835 1861382..1861951 - 570 WP_001106655.1 hypothetical protein -
DXE60_RS09840 1862139..1862327 - 189 WP_000052076.1 hypothetical protein Toxin
DXE60_RS09845 1862355..1862615 - 261 WP_001059690.1 hypothetical protein Antitoxin
DXE60_RS09850 1862957..1863160 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE60_RS09855 1863157..1863393 - 237 WP_000368687.1 hypothetical protein -
DXE60_RS09860 1863618..1864199 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE60_RS09865 1864272..1864889 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE60_RS09870 1865038..1865532 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE60_RS09875 1865931..1866353 - 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE60_RS09880 1866501..1867217 + 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294095 WP_000052076.1 NZ_LT992461:c1862327-1862139 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294095 WP_001059690.1 NZ_LT992461:c1862615-1862355 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References