Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1323106..1323903 | Replicon | chromosome |
| Accession | NZ_LT992461 | ||
| Organism | Staphylococcus aureus isolate 8_LA_272 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | DXE60_RS06970 | Protein ID | WP_031838007.1 |
| Coordinates | 1323106..1323567 (-) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | DXE60_RS06975 | Protein ID | WP_001260485.1 |
| Coordinates | 1323580..1323903 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE60_RS06945 | 1320052..1321257 | - | 1206 | WP_000264745.1 | site-specific integrase | - |
| DXE60_RS06950 | 1321383..1321997 | + | 615 | WP_000191466.1 | hypothetical protein | - |
| DXE60_RS06955 | 1321994..1322140 | - | 147 | WP_074370993.1 | hypothetical protein | - |
| DXE60_RS06960 | 1322230..1322625 | - | 396 | WP_000449655.1 | hypothetical protein | - |
| DXE60_RS06965 | 1322654..1323088 | - | 435 | WP_000755718.1 | hypothetical protein | - |
| DXE60_RS06970 | 1323106..1323567 | - | 462 | WP_031838007.1 | toxin | Toxin |
| DXE60_RS06975 | 1323580..1323903 | - | 324 | WP_001260485.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DXE60_RS06980 | 1324067..1324315 | + | 249 | WP_000272860.1 | helix-turn-helix domain-containing protein | - |
| DXE60_RS06985 | 1324331..1324576 | + | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| DXE60_RS06990 | 1324545..1324910 | - | 366 | WP_001128433.1 | hypothetical protein | - |
| DXE60_RS06995 | 1324965..1325180 | + | 216 | WP_001036302.1 | hypothetical protein | - |
| DXE60_RS07000 | 1325205..1325468 | + | 264 | WP_001124190.1 | helix-turn-helix domain-containing protein | - |
| DXE60_RS07005 | 1325481..1325642 | + | 162 | WP_001285963.1 | DUF1270 family protein | - |
| DXE60_RS07010 | 1325721..1326044 | + | 324 | WP_000174994.1 | hypothetical protein | - |
| DXE60_RS07015 | 1326059..1326421 | + | 363 | WP_031775157.1 | hypothetical protein | - |
| DXE60_RS07020 | 1326418..1327584 | + | 1167 | WP_000762547.1 | DUF2800 domain-containing protein | - |
| DXE60_RS07025 | 1327610..1328167 | + | 558 | WP_000645042.1 | DUF2815 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1320052..1364093 | 44041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18006.39 Da Isoelectric Point: 4.9167
>T294092 WP_031838007.1 NZ_LT992461:c1323567-1323106 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|