Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1648105..1648634 | Replicon | chromosome |
Accession | NZ_LT992460 | ||
Organism | Staphylococcus aureus isolate 9_LA_281 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DXE39_RS08540 | Protein ID | WP_000621175.1 |
Coordinates | 1648272..1648634 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DXE39_RS08535 | Protein ID | WP_000948331.1 |
Coordinates | 1648105..1648275 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE39_RS08505 | 1643141..1643701 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
DXE39_RS08510 | 1643910..1644389 | + | 480 | WP_001287081.1 | hypothetical protein | - |
DXE39_RS08515 | 1644382..1645959 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
DXE39_RS08520 | 1645952..1646443 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
DXE39_RS08525 | 1646447..1646806 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
DXE39_RS08530 | 1646872..1648020 | + | 1149 | WP_001281139.1 | alanine racemase | - |
DXE39_RS08535 | 1648105..1648275 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DXE39_RS08540 | 1648272..1648634 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DXE39_RS08550 | 1648984..1649985 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DXE39_RS08555 | 1650104..1650430 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DXE39_RS08560 | 1650432..1650911 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
DXE39_RS08565 | 1650886..1651656 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294078 WP_000621175.1 NZ_LT992460:1648272-1648634 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|