Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
Location | 240360..241157 | Replicon | chromosome |
Accession | NZ_LT992458 | ||
Organism | Staphylococcus aureus isolate 7_4623 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | DXE63_RS01380 | Protein ID | WP_031838007.1 |
Coordinates | 240696..241157 (+) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | DXE63_RS01375 | Protein ID | WP_001260485.1 |
Coordinates | 240360..240683 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE63_RS01325 | 236096..236653 | - | 558 | WP_000645042.1 | DUF2815 family protein | - |
DXE63_RS01330 | 236679..237845 | - | 1167 | WP_000762547.1 | DUF2800 domain-containing protein | - |
DXE63_RS01335 | 237842..238204 | - | 363 | WP_031775157.1 | hypothetical protein | - |
DXE63_RS01340 | 238219..238542 | - | 324 | WP_000174994.1 | hypothetical protein | - |
DXE63_RS01345 | 238621..238782 | - | 162 | WP_001285963.1 | DUF1270 family protein | - |
DXE63_RS01350 | 238795..239058 | - | 264 | WP_001124190.1 | helix-turn-helix domain-containing protein | - |
DXE63_RS01355 | 239083..239298 | - | 216 | WP_001036302.1 | hypothetical protein | - |
DXE63_RS01360 | 239353..239718 | + | 366 | WP_001128433.1 | hypothetical protein | - |
DXE63_RS01365 | 239687..239932 | - | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
DXE63_RS01370 | 239948..240196 | - | 249 | WP_000272860.1 | helix-turn-helix domain-containing protein | - |
DXE63_RS01375 | 240360..240683 | + | 324 | WP_001260485.1 | helix-turn-helix domain-containing protein | Antitoxin |
DXE63_RS01380 | 240696..241157 | + | 462 | WP_031838007.1 | toxin | Toxin |
DXE63_RS01385 | 241175..241609 | + | 435 | WP_000755718.1 | hypothetical protein | - |
DXE63_RS01390 | 241638..242033 | + | 396 | WP_000449655.1 | hypothetical protein | - |
DXE63_RS01395 | 242123..242269 | + | 147 | WP_074370993.1 | hypothetical protein | - |
DXE63_RS01400 | 242266..242880 | - | 615 | WP_000191466.1 | hypothetical protein | - |
DXE63_RS01405 | 243006..244211 | + | 1206 | WP_000264745.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 200170..244211 | 44041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18006.39 Da Isoelectric Point: 4.9167
>T294051 WP_031838007.1 NZ_LT992458:240696-241157 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|