Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 2569416..2570204 Replicon chromosome
Accession NZ_LT992456
Organism Staphylococcus aureus isolate 1_1439

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag DXE58_RS13325 Protein ID WP_000525004.1
Coordinates 2569416..2569877 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag DXE58_RS13330 Protein ID WP_000333630.1
Coordinates 2569890..2570204 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE58_RS13300 2564426..2566453 + 2028 WP_014532489.1 hypothetical protein -
DXE58_RS13305 2566496..2567701 - 1206 WP_031585161.1 site-specific integrase -
DXE58_RS13310 2567827..2568441 + 615 WP_001568848.1 phage protein -
DXE58_RS13315 2568438..2568584 - 147 WP_001795334.1 hypothetical protein -
DXE58_RS13320 2568814..2569398 - 585 WP_000825948.1 hypothetical protein -
DXE58_RS13325 2569416..2569877 - 462 WP_000525004.1 hypothetical protein Toxin
DXE58_RS13330 2569890..2570204 - 315 WP_000333630.1 helix-turn-helix domain-containing protein Antitoxin
DXE58_RS13335 2570356..2570592 + 237 WP_001121027.1 helix-turn-helix domain-containing protein -
DXE58_RS13340 2570606..2571382 + 777 WP_001148544.1 Rha family transcriptional regulator -
DXE58_RS15010 2571411..2571560 + 150 WP_000771849.1 hypothetical protein -
DXE58_RS13345 2571601..2571813 - 213 WP_000362644.1 hypothetical protein -
DXE58_RS13350 2571883..2572080 + 198 WP_001148860.1 hypothetical protein -
DXE58_RS13355 2572067..2572447 - 381 WP_000773059.1 DUF2513 domain-containing protein -
DXE58_RS13360 2572502..2572747 + 246 WP_001025401.1 DUF2829 domain-containing protein -
DXE58_RS13365 2572716..2573081 - 366 WP_001128433.1 hypothetical protein -
DXE58_RS13370 2573136..2573351 + 216 WP_001097552.1 hypothetical protein -
DXE58_RS13375 2573376..2573639 + 264 WP_016187436.1 helix-turn-helix domain-containing protein -
DXE58_RS13380 2573652..2573813 + 162 WP_001285948.1 DUF1270 domain-containing protein -
DXE58_RS13385 2573892..2574215 + 324 WP_000174994.1 hypothetical protein -
DXE58_RS13390 2574230..2574592 + 363 WP_031863778.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T294046 WP_000525004.1 NZ_LT992456:c2569877-2569416 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT294046 WP_000333630.1 NZ_LT992456:c2570204-2569890 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References