Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 2569416..2570204 | Replicon | chromosome |
| Accession | NZ_LT992456 | ||
| Organism | Staphylococcus aureus isolate 1_1439 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A2I7Y5B3 |
| Locus tag | DXE58_RS13325 | Protein ID | WP_000525004.1 |
| Coordinates | 2569416..2569877 (-) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | DXE58_RS13330 | Protein ID | WP_000333630.1 |
| Coordinates | 2569890..2570204 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE58_RS13300 | 2564426..2566453 | + | 2028 | WP_014532489.1 | hypothetical protein | - |
| DXE58_RS13305 | 2566496..2567701 | - | 1206 | WP_031585161.1 | site-specific integrase | - |
| DXE58_RS13310 | 2567827..2568441 | + | 615 | WP_001568848.1 | phage protein | - |
| DXE58_RS13315 | 2568438..2568584 | - | 147 | WP_001795334.1 | hypothetical protein | - |
| DXE58_RS13320 | 2568814..2569398 | - | 585 | WP_000825948.1 | hypothetical protein | - |
| DXE58_RS13325 | 2569416..2569877 | - | 462 | WP_000525004.1 | hypothetical protein | Toxin |
| DXE58_RS13330 | 2569890..2570204 | - | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DXE58_RS13335 | 2570356..2570592 | + | 237 | WP_001121027.1 | helix-turn-helix domain-containing protein | - |
| DXE58_RS13340 | 2570606..2571382 | + | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| DXE58_RS15010 | 2571411..2571560 | + | 150 | WP_000771849.1 | hypothetical protein | - |
| DXE58_RS13345 | 2571601..2571813 | - | 213 | WP_000362644.1 | hypothetical protein | - |
| DXE58_RS13350 | 2571883..2572080 | + | 198 | WP_001148860.1 | hypothetical protein | - |
| DXE58_RS13355 | 2572067..2572447 | - | 381 | WP_000773059.1 | DUF2513 domain-containing protein | - |
| DXE58_RS13360 | 2572502..2572747 | + | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| DXE58_RS13365 | 2572716..2573081 | - | 366 | WP_001128433.1 | hypothetical protein | - |
| DXE58_RS13370 | 2573136..2573351 | + | 216 | WP_001097552.1 | hypothetical protein | - |
| DXE58_RS13375 | 2573376..2573639 | + | 264 | WP_016187436.1 | helix-turn-helix domain-containing protein | - |
| DXE58_RS13380 | 2573652..2573813 | + | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
| DXE58_RS13385 | 2573892..2574215 | + | 324 | WP_000174994.1 | hypothetical protein | - |
| DXE58_RS13390 | 2574230..2574592 | + | 363 | WP_031863778.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T294046 WP_000525004.1 NZ_LT992456:c2569877-2569416 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |