Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 2209186..2209962 | Replicon | chromosome |
Accession | NZ_LT992456 | ||
Organism | Staphylococcus aureus isolate 1_1439 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | DXE58_RS11450 | Protein ID | WP_000031108.1 |
Coordinates | 2209810..2209962 (+) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DXE58_RS11445 | Protein ID | WP_001251224.1 |
Coordinates | 2209186..2209785 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE58_RS11425 | 2205102..2206559 | + | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
DXE58_RS11430 | 2206552..2207274 | + | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
DXE58_RS11435 | 2207425..2208552 | + | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DXE58_RS11440 | 2208557..2209027 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DXE58_RS11445 | 2209186..2209785 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DXE58_RS11450 | 2209810..2209962 | + | 153 | WP_000031108.1 | hypothetical protein | Toxin |
DXE58_RS11460 | 2210505..2210900 | + | 396 | WP_000901018.1 | hypothetical protein | - |
DXE58_RS11465 | 2211096..2212481 | + | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
DXE58_RS11470 | 2212936..2213757 | - | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T294045 WP_000031108.1 NZ_LT992456:2209810-2209962 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT294045 WP_001251224.1 NZ_LT992456:2209186-2209785 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|