Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 447776..448252 Replicon chromosome
Accession NZ_LT992456
Organism Staphylococcus aureus isolate 1_1439

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE58_RS02310 Protein ID WP_000052076.1
Coordinates 448064..448252 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE58_RS02305 Protein ID WP_001059690.1
Coordinates 447776..448036 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE58_RS02270 443174..443890 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
DXE58_RS02275 444038..444460 + 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE58_RS02280 444859..445353 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE58_RS02285 445502..446119 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE58_RS02290 446192..446773 - 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE58_RS02295 446998..447234 + 237 WP_000368687.1 hypothetical protein -
DXE58_RS02300 447231..447434 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE58_RS02305 447776..448036 + 261 WP_001059690.1 hypothetical protein Antitoxin
DXE58_RS02310 448064..448252 + 189 WP_000052076.1 hypothetical protein Toxin
DXE58_RS02315 448440..449009 + 570 WP_001106655.1 hypothetical protein -
DXE58_RS02320 449097..449381 + 285 WP_001004403.1 hypothetical protein -
DXE58_RS02325 449442..449660 + 219 WP_000005881.1 hypothetical protein -
DXE58_RS02330 450157..450357 - 201 WP_001059082.1 cold-shock protein -
DXE58_RS02335 450714..451400 - 687 WP_001574556.1 thermonuclease family protein -
DXE58_RS02340 451741..452223 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294035 WP_000052076.1 NZ_LT992456:448064-448252 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294035 WP_001059690.1 NZ_LT992456:447776-448036 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References