294031

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2589936..2590413 Replicon chromosome
Accession NZ_LT992436
Organism Staphylococcus aureus isolate 1549-REV

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DYY98_RS13275 Protein ID WP_000052076.1
Coordinates 2589936..2590124 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DYY98_RS13280 Protein ID WP_001059690.1
Coordinates 2590153..2590413 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DYY98_RS13245 2585926..2586447 + 522 WP_000824479.1 hypothetical protein -
DYY98_RS13250 2586788..2587474 + 687 WP_001622483.1 thermonuclease family protein -
DYY98_RS13255 2587831..2588031 + 201 WP_001059082.1 cold-shock protein -
DYY98_RS13260 2588528..2588746 - 219 WP_000005884.1 hypothetical protein -
DYY98_RS13265 2588819..2589091 - 273 WP_001004400.1 hypothetical protein -
DYY98_RS13270 2589179..2589748 - 570 WP_001106662.1 hypothetical protein -
DYY98_RS13275 2589936..2590124 - 189 WP_000052076.1 hypothetical protein Toxin
DYY98_RS13280 2590153..2590413 - 261 WP_001059690.1 hypothetical protein Antitoxin
DYY98_RS13285 2590754..2590957 + 204 WP_000145160.1 sterile alpha motif-like domain-containing protein -
DYY98_RS13290 2590954..2591190 - 237 WP_000368687.1 hypothetical protein -
DYY98_RS13295 2591414..2591995 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DYY98_RS13300 2592068..2592685 - 618 WP_000255550.1 LysE/ArgO family amino acid transporter -
DYY98_RS13305 2592841..2593335 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
DYY98_RS13310 2593734..2594156 - 423 WP_000974451.1 organic hydroperoxide resistance protein -
DYY98_RS13315 2594304..2595020 + 717 WP_000150033.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - sec / sell / vWbp 2557943..2600707 42764


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294031 WP_000052076.1 NZ_LT992436:c2590124-2589936 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294031 WP_001059690.1 NZ_LT992436:c2590413-2590153 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References