Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 890020..890796 | Replicon | chromosome |
Accession | NZ_LT992436 | ||
Organism | Staphylococcus aureus isolate 1549-REV |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | DYY98_RS04440 | Protein ID | WP_000031109.1 |
Coordinates | 890020..890172 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DYY98_RS04445 | Protein ID | WP_001251224.1 |
Coordinates | 890197..890796 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY98_RS04420 | 885826..886647 | + | 822 | WP_000669377.1 | RluA family pseudouridine synthase | - |
DYY98_RS04425 | 887104..888489 | - | 1386 | WP_000116239.1 | class II fumarate hydratase | - |
DYY98_RS04430 | 888685..889080 | - | 396 | WP_000901019.1 | hypothetical protein | - |
DYY98_RS04440 | 890020..890172 | - | 153 | WP_000031109.1 | hypothetical protein | Toxin |
DYY98_RS04445 | 890197..890796 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DYY98_RS04450 | 890955..891425 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DYY98_RS04455 | 891430..892557 | - | 1128 | WP_000379990.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DYY98_RS04460 | 892708..893430 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
DYY98_RS04465 | 893423..894880 | - | 1458 | WP_000649916.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5950.31 Da Isoelectric Point: 3.9075
>T294024 WP_000031109.1 NZ_LT992436:c890172-890020 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEESQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEESQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT294024 WP_001251224.1 NZ_LT992436:c890796-890197 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|