Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2589935..2590412 Replicon chromosome
Accession NZ_LT992435
Organism Staphylococcus aureus isolate 1549-SCV

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DYY96_RS13275 Protein ID WP_000052076.1
Coordinates 2589935..2590123 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DYY96_RS13280 Protein ID WP_001059690.1
Coordinates 2590152..2590412 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DYY96_RS13245 2585925..2586446 + 522 WP_000824479.1 hypothetical protein -
DYY96_RS13250 2586787..2587473 + 687 WP_001622483.1 thermonuclease family protein -
DYY96_RS13255 2587830..2588030 + 201 WP_001059082.1 cold-shock protein -
DYY96_RS13260 2588527..2588745 - 219 WP_000005884.1 hypothetical protein -
DYY96_RS13265 2588818..2589090 - 273 WP_001004400.1 hypothetical protein -
DYY96_RS13270 2589178..2589747 - 570 WP_001106662.1 hypothetical protein -
DYY96_RS13275 2589935..2590123 - 189 WP_000052076.1 hypothetical protein Toxin
DYY96_RS13280 2590152..2590412 - 261 WP_001059690.1 hypothetical protein Antitoxin
DYY96_RS13285 2590753..2590956 + 204 WP_000145160.1 sterile alpha motif-like domain-containing protein -
DYY96_RS13290 2590953..2591189 - 237 WP_000368687.1 hypothetical protein -
DYY96_RS13295 2591413..2591994 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DYY96_RS13300 2592067..2592684 - 618 WP_000255550.1 LysE/ArgO family amino acid transporter -
DYY96_RS13305 2592840..2593334 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
DYY96_RS13310 2593733..2594155 - 423 WP_000974451.1 organic hydroperoxide resistance protein -
DYY96_RS13315 2594303..2595019 + 717 WP_000150033.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - sec / sell / vWbp 2557942..2600706 42764


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294023 WP_000052076.1 NZ_LT992435:c2590123-2589935 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294023 WP_001059690.1 NZ_LT992435:c2590412-2590152 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References