Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2560585..2561114 Replicon chromosome
Accession NZ_LT992435
Organism Staphylococcus aureus isolate 1549-SCV

Toxin (Protein)


Gene name TscT Uniprot ID K7ZRX6
Locus tag DYY96_RS13110 Protein ID WP_001103939.1
Coordinates 2560797..2561114 (+) Length 106 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IY59
Locus tag DYY96_RS13105 Protein ID WP_001058494.1
Coordinates 2560585..2560794 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DYY96_RS13070 2556915..2557379 + 465 WP_001085185.1 SsrA-binding protein SmpB -
DYY96_RS13080 2557942..2559048 - 1107 WP_000149511.1 site-specific integrase -
DYY96_RS13085 2559038..2559841 - 804 WP_000358990.1 helix-turn-helix domain-containing protein -
DYY96_RS13090 2559977..2560180 + 204 WP_001045296.1 transcriptional regulator -
DYY96_RS13095 2560216..2560434 + 219 WP_000163544.1 helix-turn-helix domain-containing protein -
DYY96_RS13100 2560446..2560592 + 147 WP_000784885.1 hypothetical protein -
DYY96_RS13105 2560585..2560794 + 210 WP_001058494.1 hypothetical protein Antitoxin
DYY96_RS13110 2560797..2561114 + 318 WP_001103939.1 DUF1474 family protein Toxin
DYY96_RS13115 2561178..2562047 + 870 WP_001002717.1 primase alpha helix C-terminal domain-containing protein -
DYY96_RS13120 2562064..2562588 + 525 WP_111125118.1 hypothetical protein -
DYY96_RS13125 2562600..2563729 + 1130 WP_115657120.1 IS3 family transposase -
DYY96_RS13130 2563746..2564747 + 1002 Protein_2440 virulence-associated protein E -
DYY96_RS13135 2565048..2565410 + 363 WP_001039170.1 hypothetical protein -
DYY96_RS13140 2565412..2565696 + 285 WP_000998185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - sec / sell / vWbp 2557942..2600706 42764
- flank IS/Tn - - 2562600..2562881 281


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12547.17 Da        Isoelectric Point: 5.0161

>T294022 WP_001103939.1 NZ_LT992435:2560797-2561114 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE

Download         Length: 318 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8268.31 Da        Isoelectric Point: 4.3718

>AT294022 WP_001058494.1 NZ_LT992435:2560585-2560794 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNSIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB K7ZRX6

Antitoxin

Source ID Structure
AlphaFold DB X5IY59

References