Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 2560585..2561114 | Replicon | chromosome |
| Accession | NZ_LT992435 | ||
| Organism | Staphylococcus aureus isolate 1549-SCV | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | K7ZRX6 |
| Locus tag | DYY96_RS13110 | Protein ID | WP_001103939.1 |
| Coordinates | 2560797..2561114 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IY59 |
| Locus tag | DYY96_RS13105 | Protein ID | WP_001058494.1 |
| Coordinates | 2560585..2560794 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DYY96_RS13070 | 2556915..2557379 | + | 465 | WP_001085185.1 | SsrA-binding protein SmpB | - |
| DYY96_RS13080 | 2557942..2559048 | - | 1107 | WP_000149511.1 | site-specific integrase | - |
| DYY96_RS13085 | 2559038..2559841 | - | 804 | WP_000358990.1 | helix-turn-helix domain-containing protein | - |
| DYY96_RS13090 | 2559977..2560180 | + | 204 | WP_001045296.1 | transcriptional regulator | - |
| DYY96_RS13095 | 2560216..2560434 | + | 219 | WP_000163544.1 | helix-turn-helix domain-containing protein | - |
| DYY96_RS13100 | 2560446..2560592 | + | 147 | WP_000784885.1 | hypothetical protein | - |
| DYY96_RS13105 | 2560585..2560794 | + | 210 | WP_001058494.1 | hypothetical protein | Antitoxin |
| DYY96_RS13110 | 2560797..2561114 | + | 318 | WP_001103939.1 | DUF1474 family protein | Toxin |
| DYY96_RS13115 | 2561178..2562047 | + | 870 | WP_001002717.1 | primase alpha helix C-terminal domain-containing protein | - |
| DYY96_RS13120 | 2562064..2562588 | + | 525 | WP_111125118.1 | hypothetical protein | - |
| DYY96_RS13125 | 2562600..2563729 | + | 1130 | WP_115657120.1 | IS3 family transposase | - |
| DYY96_RS13130 | 2563746..2564747 | + | 1002 | Protein_2440 | virulence-associated protein E | - |
| DYY96_RS13135 | 2565048..2565410 | + | 363 | WP_001039170.1 | hypothetical protein | - |
| DYY96_RS13140 | 2565412..2565696 | + | 285 | WP_000998185.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sec / sell / vWbp | 2557942..2600706 | 42764 | |
| - | flank | IS/Tn | - | - | 2562600..2562881 | 281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12547.17 Da Isoelectric Point: 5.0161
>T294022 WP_001103939.1 NZ_LT992435:2560797-2561114 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|