Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1083858..1084387 | Replicon | chromosome |
Accession | NZ_LT992435 | ||
Organism | Staphylococcus aureus isolate 1549-SCV |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DYY96_RS05675 | Protein ID | WP_000621175.1 |
Coordinates | 1083858..1084220 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DYY96_RS05680 | Protein ID | WP_000948331.1 |
Coordinates | 1084217..1084387 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY96_RS05650 | 1080837..1081607 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
DYY96_RS05655 | 1081582..1082061 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
DYY96_RS05660 | 1082063..1082389 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DYY96_RS05665 | 1082508..1083509 | - | 1002 | WP_042744356.1 | PP2C family protein-serine/threonine phosphatase | - |
DYY96_RS05675 | 1083858..1084220 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DYY96_RS05680 | 1084217..1084387 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DYY96_RS05685 | 1084472..1085620 | - | 1149 | WP_001281140.1 | alanine racemase | - |
DYY96_RS05690 | 1085686..1086045 | - | 360 | WP_000581199.1 | holo-ACP synthase | - |
DYY96_RS05695 | 1086049..1086540 | - | 492 | WP_001205907.1 | PH domain-containing protein | - |
DYY96_RS05700 | 1086527..1088110 | - | 1584 | WP_001294637.1 | PH domain-containing protein | - |
DYY96_RS05705 | 1088103..1088582 | - | 480 | WP_001287077.1 | hypothetical protein | - |
DYY96_RS05710 | 1088790..1089350 | - | 561 | WP_001092406.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294019 WP_000621175.1 NZ_LT992435:c1084220-1083858 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|