Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2589909..2590386 Replicon chromosome
Accession NZ_LT992434
Organism Staphylococcus aureus isolate 1549-WT

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DYY92_RS13280 Protein ID WP_000052076.1
Coordinates 2589909..2590097 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DYY92_RS13285 Protein ID WP_001059690.1
Coordinates 2590126..2590386 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DYY92_RS13250 2585899..2586420 + 522 WP_000824479.1 hypothetical protein -
DYY92_RS13255 2586761..2587447 + 687 WP_001622483.1 thermonuclease family protein -
DYY92_RS13260 2587804..2588004 + 201 WP_001059082.1 cold-shock protein -
DYY92_RS13265 2588501..2588719 - 219 WP_000005884.1 hypothetical protein -
DYY92_RS13270 2588792..2589064 - 273 WP_001004400.1 hypothetical protein -
DYY92_RS13275 2589152..2589721 - 570 WP_001106662.1 hypothetical protein -
DYY92_RS13280 2589909..2590097 - 189 WP_000052076.1 hypothetical protein Toxin
DYY92_RS13285 2590126..2590386 - 261 WP_001059690.1 hypothetical protein Antitoxin
DYY92_RS13290 2590727..2590930 + 204 WP_000145160.1 sterile alpha motif-like domain-containing protein -
DYY92_RS13295 2590927..2591163 - 237 WP_000368687.1 hypothetical protein -
DYY92_RS13300 2591387..2591968 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DYY92_RS13305 2592041..2592658 - 618 WP_000255550.1 LysE/ArgO family amino acid transporter -
DYY92_RS13310 2592814..2593308 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
DYY92_RS13315 2593707..2594129 - 423 WP_000974451.1 organic hydroperoxide resistance protein -
DYY92_RS13320 2594277..2594993 + 717 WP_000150033.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - sec / sell / vWbp 2557916..2600680 42764


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294015 WP_000052076.1 NZ_LT992434:c2590097-2589909 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294015 WP_001059690.1 NZ_LT992434:c2590386-2590126 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References