Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2560559..2561088 Replicon chromosome
Accession NZ_LT992434
Organism Staphylococcus aureus isolate 1549-WT

Toxin (Protein)


Gene name TscT Uniprot ID K7ZRX6
Locus tag DYY92_RS13115 Protein ID WP_001103939.1
Coordinates 2560771..2561088 (+) Length 106 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IY59
Locus tag DYY92_RS13110 Protein ID WP_001058494.1
Coordinates 2560559..2560768 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DYY92_RS13075 2556889..2557353 + 465 WP_001085185.1 SsrA-binding protein SmpB -
DYY92_RS13085 2557916..2559022 - 1107 WP_000149511.1 site-specific integrase -
DYY92_RS13090 2559012..2559815 - 804 WP_000358990.1 helix-turn-helix domain-containing protein -
DYY92_RS13095 2559951..2560154 + 204 WP_001045296.1 transcriptional regulator -
DYY92_RS13100 2560190..2560408 + 219 WP_000163544.1 helix-turn-helix domain-containing protein -
DYY92_RS13105 2560420..2560566 + 147 WP_000784885.1 hypothetical protein -
DYY92_RS13110 2560559..2560768 + 210 WP_001058494.1 hypothetical protein Antitoxin
DYY92_RS13115 2560771..2561088 + 318 WP_001103939.1 DUF1474 family protein Toxin
DYY92_RS13120 2561152..2562021 + 870 WP_001002717.1 primase alpha helix C-terminal domain-containing protein -
DYY92_RS13125 2562038..2562562 + 525 WP_111125118.1 hypothetical protein -
DYY92_RS13130 2562574..2563703 + 1130 WP_115657120.1 IS3 family transposase -
DYY92_RS13135 2563720..2564721 + 1002 Protein_2439 virulence-associated protein E -
DYY92_RS13140 2565022..2565384 + 363 WP_001039170.1 hypothetical protein -
DYY92_RS13145 2565386..2565670 + 285 WP_000998185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - sec / sell / vWbp 2557916..2600680 42764
- flank IS/Tn - - 2562574..2562855 281


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12547.17 Da        Isoelectric Point: 5.0161

>T294014 WP_001103939.1 NZ_LT992434:2560771-2561088 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE

Download         Length: 318 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8268.31 Da        Isoelectric Point: 4.3718

>AT294014 WP_001058494.1 NZ_LT992434:2560559-2560768 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNSIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB K7ZRX6

Antitoxin

Source ID Structure
AlphaFold DB X5IY59

References