Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 40866..41509 Replicon plasmid pC45-p2
Accession NZ_LT991959
Organism Enterobacter cloacae complex sp. isolate C45

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag DBR02_RS25460 Protein ID WP_000754566.1
Coordinates 41093..41509 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag DBR02_RS25455 Protein ID WP_001261276.1
Coordinates 40866..41096 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DBR02_RS25415 36195..37124 + 930 WP_004118344.1 copper resistance inner membrane protein PcoD -
DBR02_RS25420 37179..37859 + 681 WP_001188930.1 copper response regulator transcription factor PcoR -
DBR02_RS25425 37856..39256 + 1401 WP_004118346.1 copper resistance membrane spanning protein PcoS -
DBR02_RS25430 39472..39906 + 435 WP_004118347.1 hypothetical protein -
DBR02_RS25440 40284..40382 - 99 WP_004118348.1 type II toxin-antitoxin system RelE/ParE family toxin -
DBR02_RS25445 40369..40548 - 180 WP_004118349.1 type II toxin-antitoxin system ParD family antitoxin -
DBR02_RS25455 40866..41096 + 231 WP_001261276.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
DBR02_RS25460 41093..41509 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
DBR02_RS25465 41713..42398 + 686 Protein_38 IS3 family transposase -
DBR02_RS25475 43071..44579 + 1509 WP_001189109.1 group II intron reverse transcriptase/maturase -
DBR02_RS25480 44660..44839 + 180 Protein_40 DDE-type integrase/transposase/recombinase -
DBR02_RS25490 45120..46202 + 1083 WP_069219573.1 IS110 family transposase -
DBR02_RS25495 46219..46389 + 171 Protein_42 DDE-type integrase/transposase/recombinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / aph(6)-Id / aph(3'')-Ib - 1..142732 142732


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T294007 WP_000754566.1 NZ_LT991959:41093-41509 [Enterobacter cloacae complex sp.]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT294007 WP_001261276.1 NZ_LT991959:40866-41096 [Enterobacter cloacae complex sp.]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References