Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 12825..13351 | Replicon | plasmid pC45-p2 |
| Accession | NZ_LT991959 | ||
| Organism | Enterobacter cloacae complex sp. isolate C45 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | DBR02_RS25305 | Protein ID | WP_107535700.1 |
| Coordinates | 12825..13112 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | DBR02_RS25310 | Protein ID | WP_000534858.1 |
| Coordinates | 13112..13351 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR02_RS25300 | 11645..12634 | + | 990 | WP_107535699.1 | tyrosine-type recombinase/integrase | - |
| DBR02_RS25305 | 12825..13112 | - | 288 | WP_107535700.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| DBR02_RS25310 | 13112..13351 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| DBR02_RS25320 | 14509..15090 | + | 582 | WP_004118277.1 | hypothetical protein | - |
| DBR02_RS25325 | 15238..16269 | + | 1032 | WP_004118274.1 | Abi family protein | - |
| DBR02_RS25330 | 16822..17730 | + | 909 | WP_107535757.1 | HNH endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / aph(6)-Id / aph(3'')-Ib | - | 1..142732 | 142732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11241.22 Da Isoelectric Point: 10.1967
>T294006 WP_107535700.1 NZ_LT991959:c13112-12825 [Enterobacter cloacae complex sp.]
MTYFLDFDERALKEWRKLGSTVREQLKKKLAEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVIVFVISVGK
RERSEVYSEAVKRIL
MTYFLDFDERALKEWRKLGSTVREQLKKKLAEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVIVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4FXE | |
| PDB | 2KC8 | |
| PDB | 2K29 | |
| AlphaFold DB | A0A4V1CTS8 |