Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 241082..241608 | Replicon | plasmid pC45-VIM4 |
| Accession | NZ_LT991958 | ||
| Organism | Enterobacter cloacae complex sp. isolate C45 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | DBR02_RS24900 | Protein ID | WP_000323025.1 |
| Coordinates | 241082..241369 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | DBR02_RS24905 | Protein ID | WP_000534858.1 |
| Coordinates | 241369..241608 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR02_RS26830 | 236652..236828 | - | 177 | WP_001371930.1 | hypothetical protein | - |
| DBR02_RS24870 | 237339..238283 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
| DBR02_RS24875 | 238382..238981 | + | 600 | WP_001031420.1 | hypothetical protein | - |
| DBR02_RS24880 | 239041..239391 | + | 351 | WP_000743059.1 | hypothetical protein | - |
| DBR02_RS24885 | 239438..239641 | + | 204 | WP_001015183.1 | hypothetical protein | - |
| DBR02_RS24890 | 239923..240243 | + | 321 | WP_000332796.1 | hypothetical protein | - |
| DBR02_RS24895 | 240852..241010 | - | 159 | WP_001447866.1 | type I toxin-antitoxin system Hok family toxin | - |
| DBR02_RS24900 | 241082..241369 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| DBR02_RS24905 | 241369..241608 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| DBR02_RS24915 | 241871..242794 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| DBR02_RS24920 | 242994..243566 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| DBR02_RS24925 | 244042..245280 | - | 1239 | WP_000219087.1 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaVIM-4 / aac(6')-Il / dfrA1 / aadA1 / qacE / sul1 / blaTEM-1B / ant(2'')-Ia / aadA2 / qnrA1 / tet(A) / mcr-9 | - | 1..299117 | 299117 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T294005 WP_000323025.1 NZ_LT991958:c241369-241082 [Enterobacter cloacae complex sp.]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|