Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4333455..4334200 | Replicon | chromosome |
| Accession | NZ_LT991957 | ||
| Organism | Enterobacter cloacae complex sp. isolate C45 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | DBR02_RS21290 | Protein ID | WP_107535371.1 |
| Coordinates | 4333455..4333946 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A4R0FU91 |
| Locus tag | DBR02_RS21295 | Protein ID | WP_063451299.1 |
| Coordinates | 4333934..4334200 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR02_RS21265 | 4328642..4329400 | + | 759 | WP_107535367.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DBR02_RS21270 | 4329505..4330797 | + | 1293 | WP_107535368.1 | glycoside hydrolase | - |
| DBR02_RS21275 | 4330883..4331551 | + | 669 | WP_063451313.1 | epoxyqueuosine reductase QueH | - |
| DBR02_RS21280 | 4331823..4332788 | + | 966 | WP_107535369.1 | hypothetical protein | - |
| DBR02_RS21285 | 4332804..4333373 | + | 570 | WP_107535370.1 | hypothetical protein | - |
| DBR02_RS21290 | 4333455..4333946 | - | 492 | WP_107535371.1 | GNAT family N-acetyltransferase | Toxin |
| DBR02_RS21295 | 4333934..4334200 | - | 267 | WP_063451299.1 | DUF1778 domain-containing protein | Antitoxin |
| DBR02_RS21300 | 4334288..4335202 | - | 915 | WP_107535372.1 | LysR family transcriptional regulator | - |
| DBR02_RS21305 | 4335330..4336709 | + | 1380 | WP_107535677.1 | DHA2 family efflux MFS transporter permease subunit | - |
| DBR02_RS21310 | 4336722..4337717 | - | 996 | WP_107535373.1 | DUF2891 domain-containing protein | - |
| DBR02_RS21315 | 4337727..4338713 | - | 987 | WP_063866697.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17825.62 Da Isoelectric Point: 10.2227
>T293999 WP_107535371.1 NZ_LT991957:c4333946-4333455 [Enterobacter cloacae complex sp.]
VGRVTAPEPLTSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIVLARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFRASQTQERTLFLRLP
LTR
VGRVTAPEPLTSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIVLARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFRASQTQERTLFLRLP
LTR
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|