Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3230307..3230927 | Replicon | chromosome |
| Accession | NZ_LT991957 | ||
| Organism | Enterobacter cloacae complex sp. isolate C45 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V3PUI7 |
| Locus tag | DBR02_RS15965 | Protein ID | WP_010428174.1 |
| Coordinates | 3230307..3230525 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | DBR02_RS15970 | Protein ID | WP_006809850.1 |
| Coordinates | 3230553..3230927 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR02_RS15940 | 3226728..3228296 | - | 1569 | WP_107534814.1 | EAL domain-containing protein | - |
| DBR02_RS15945 | 3228523..3228783 | + | 261 | WP_063451670.1 | type B 50S ribosomal protein L31 | - |
| DBR02_RS15950 | 3228786..3228926 | + | 141 | WP_063451669.1 | type B 50S ribosomal protein L36 | - |
| DBR02_RS15955 | 3228964..3229431 | - | 468 | WP_107534815.1 | hypothetical protein | - |
| DBR02_RS15960 | 3229548..3230099 | - | 552 | WP_107534816.1 | maltose O-acetyltransferase | - |
| DBR02_RS15965 | 3230307..3230525 | - | 219 | WP_010428174.1 | hemolysin expression modulator Hha | Toxin |
| DBR02_RS15970 | 3230553..3230927 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| DBR02_RS15975 | 3231437..3234583 | - | 3147 | WP_063451666.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| DBR02_RS15980 | 3234606..3235799 | - | 1194 | WP_063451665.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8597.97 Da Isoelectric Point: 8.9008
>T293998 WP_010428174.1 NZ_LT991957:c3230525-3230307 [Enterobacter cloacae complex sp.]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT293998 WP_006809850.1 NZ_LT991957:c3230927-3230553 [Enterobacter cloacae complex sp.]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PUI7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |