Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 3113791..3114506 | Replicon | chromosome |
Accession | NZ_LT991957 | ||
Organism | Enterobacter cloacae complex sp. isolate C45 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | A0A8I0UM05 |
Locus tag | DBR02_RS15415 | Protein ID | WP_023303149.1 |
Coordinates | 3114138..3114506 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A8I0UJV2 |
Locus tag | DBR02_RS15410 | Protein ID | WP_023303148.1 |
Coordinates | 3113791..3114117 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DBR02_RS15380 | 3108825..3110090 | + | 1266 | WP_023303143.1 | hypothetical protein | - |
DBR02_RS15385 | 3110399..3110833 | + | 435 | WP_023303144.1 | hypothetical protein | - |
DBR02_RS15390 | 3110892..3111731 | + | 840 | WP_023303145.1 | hypothetical protein | - |
DBR02_RS15400 | 3112421..3113242 | + | 822 | WP_023303146.1 | DUF945 domain-containing protein | - |
DBR02_RS15405 | 3113308..3113778 | + | 471 | WP_023303147.1 | DNA repair protein RadC | - |
DBR02_RS15410 | 3113791..3114117 | + | 327 | WP_023303148.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
DBR02_RS15415 | 3114138..3114506 | + | 369 | WP_023303149.1 | TA system toxin CbtA family protein | Toxin |
DBR02_RS15420 | 3114863..3116800 | - | 1938 | WP_107534771.1 | bifunctional diguanylate cyclase/phosphodiesterase | - |
DBR02_RS15425 | 3116818..3117312 | - | 495 | WP_063869143.1 | molybdopterin-dependent oxidoreductase | - |
DBR02_RS26605 | 3117674..3117838 | + | 165 | WP_157959557.1 | hypothetical protein | - |
DBR02_RS15430 | 3117855..3118364 | + | 510 | WP_107534772.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3094304..3118364 | 24060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13727.91 Da Isoelectric Point: 8.2822
>T293997 WP_023303149.1 NZ_LT991957:3114138-3114506 [Enterobacter cloacae complex sp.]
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
Download Length: 369 bp
Antitoxin
Download Length: 109 a.a. Molecular weight: 12215.04 Da Isoelectric Point: 7.0266
>AT293997 WP_023303148.1 NZ_LT991957:3113791-3114117 [Enterobacter cloacae complex sp.]
MSLIPAHEWGIKSDIVPRLGVRLVQEGNRLHYLADRASITGKFSDAECLKLDIVFPHFIRQMESMLTTGEMNSRHAHCVT
LYHNGFTCEADTLGSCGYVYIAIYPTQR
MSLIPAHEWGIKSDIVPRLGVRLVQEGNRLHYLADRASITGKFSDAECLKLDIVFPHFIRQMESMLTTGEMNSRHAHCVT
LYHNGFTCEADTLGSCGYVYIAIYPTQR
Download Length: 327 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|