Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 2172921..2173583 | Replicon | chromosome |
| Accession | NZ_LT991957 | ||
| Organism | Enterobacter cloacae complex sp. isolate C45 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | DBR02_RS10875 | Protein ID | WP_107534356.1 |
| Coordinates | 2173185..2173583 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | DBR02_RS10870 | Protein ID | WP_107534354.1 |
| Coordinates | 2172921..2173181 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR02_RS10845 | 2168136..2169257 | - | 1122 | WP_107534350.1 | efflux RND transporter periplasmic adaptor subunit | - |
| DBR02_RS10850 | 2169405..2169974 | - | 570 | WP_022646570.1 | TetR/AcrR family transcriptional regulator | - |
| DBR02_RS10855 | 2170161..2170580 | + | 420 | WP_063452086.1 | GNAT family N-acetyltransferase | - |
| DBR02_RS10860 | 2170577..2171224 | - | 648 | WP_107534352.1 | TetR/AcrR family transcriptional regulator | - |
| DBR02_RS10865 | 2171304..2172803 | + | 1500 | WP_063868676.1 | MFS transporter | - |
| DBR02_RS10870 | 2172921..2173181 | + | 261 | WP_107534354.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| DBR02_RS10875 | 2173185..2173583 | + | 399 | WP_107534356.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DBR02_RS10880 | 2173773..2174573 | + | 801 | WP_107534357.1 | lipoprotein NlpA | - |
| DBR02_RS10885 | 2174592..2175272 | - | 681 | WP_107534359.1 | EAL domain-containing protein | - |
| DBR02_RS10890 | 2175347..2175967 | - | 621 | WP_063868682.1 | response regulator transcription factor | - |
| DBR02_RS10895 | 2176542..2177177 | + | 636 | WP_107534361.1 | helix-turn-helix transcriptional regulator | - |
| DBR02_RS10900 | 2177184..2178248 | - | 1065 | WP_107534363.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14721.93 Da Isoelectric Point: 5.9786
>T293996 WP_107534356.1 NZ_LT991957:2173185-2173583 [Enterobacter cloacae complex sp.]
MLHMLDTNIVSHLVRQHPEVVNRYSQITPEKMCISSVTEAELLYGVAKKQNNKLHETIMEFLKTITICAWDSEAAATYGE
LRAAMEKKGKVMGDLDQLIAAHAISRGTTIVTNDRAFGMVQDLTVEDWTTAA
MLHMLDTNIVSHLVRQHPEVVNRYSQITPEKMCISSVTEAELLYGVAKKQNNKLHETIMEFLKTITICAWDSEAAATYGE
LRAAMEKKGKVMGDLDQLIAAHAISRGTTIVTNDRAFGMVQDLTVEDWTTAA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|