Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-RHH |
| Location | 2028211..2028827 | Replicon | chromosome |
| Accession | NZ_LT991957 | ||
| Organism | Enterobacter cloacae complex sp. isolate C45 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | DBR02_RS10155 | Protein ID | WP_077221056.1 |
| Coordinates | 2028211..2028582 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A4R0FQN1 |
| Locus tag | DBR02_RS10160 | Protein ID | WP_063449683.1 |
| Coordinates | 2028585..2028827 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR02_RS10140 | 2025711..2026613 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
| DBR02_RS10145 | 2026610..2027245 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| DBR02_RS10150 | 2027242..2028171 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| DBR02_RS10155 | 2028211..2028582 | - | 372 | WP_077221056.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DBR02_RS10160 | 2028585..2028827 | - | 243 | WP_063449683.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| DBR02_RS10165 | 2029026..2029946 | + | 921 | WP_107534259.1 | alpha/beta hydrolase | - |
| DBR02_RS10170 | 2029955..2030896 | - | 942 | WP_063449681.1 | fatty acid biosynthesis protein FabY | - |
| DBR02_RS10175 | 2030941..2031378 | - | 438 | WP_063449680.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| DBR02_RS10180 | 2031375..2032256 | - | 882 | WP_063449679.1 | virulence factor BrkB family protein | - |
| DBR02_RS10185 | 2032250..2032849 | - | 600 | WP_107534261.1 | glucose-1-phosphatase | - |
| DBR02_RS10190 | 2032968..2033768 | - | 801 | WP_107534263.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13567.63 Da Isoelectric Point: 6.7549
>T293994 WP_077221056.1 NZ_LT991957:c2028582-2028211 [Enterobacter cloacae complex sp.]
MEHMAVFDTNILIDLFNNHVEAADTIDRTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVVLR
EKHGMKLPDAIILATAQSRNCPLVSRNTKDFAGIAGVVSPYQL
MEHMAVFDTNILIDLFNNHVEAADTIDRTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVVLR
EKHGMKLPDAIILATAQSRNCPLVSRNTKDFAGIAGVVSPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|