Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1905224..1905828 | Replicon | chromosome |
| Accession | NZ_LT991957 | ||
| Organism | Enterobacter cloacae complex sp. isolate C45 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A4Q4AAS0 |
| Locus tag | DBR02_RS09590 | Protein ID | WP_057979982.1 |
| Coordinates | 1905643..1905828 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A4Q4AAR0 |
| Locus tag | DBR02_RS09585 | Protein ID | WP_063865844.1 |
| Coordinates | 1905224..1905628 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR02_RS09570 | 1901137..1903167 | + | 2031 | WP_107534191.1 | alpha-amylase | - |
| DBR02_RS09575 | 1903298..1904551 | + | 1254 | WP_063865841.1 | valine--pyruvate transaminase | - |
| DBR02_RS09580 | 1904559..1905014 | - | 456 | WP_063865843.1 | 4Fe-4S dicluster domain-containing protein | - |
| DBR02_RS09585 | 1905224..1905628 | - | 405 | WP_063865844.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| DBR02_RS09590 | 1905643..1905828 | - | 186 | WP_057979982.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| DBR02_RS09595 | 1906073..1907611 | - | 1539 | WP_063865846.1 | aldehyde dehydrogenase AldB | - |
| DBR02_RS09600 | 1907778..1908662 | + | 885 | WP_107534193.1 | ROK family protein | - |
| DBR02_RS09605 | 1908666..1910504 | - | 1839 | WP_107534195.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6852.08 Da Isoelectric Point: 11.5191
>T293993 WP_057979982.1 NZ_LT991957:c1905828-1905643 [Enterobacter cloacae complex sp.]
VKSADIITVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIITVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 15055.02 Da Isoelectric Point: 4.3984
>AT293993 WP_063865844.1 NZ_LT991957:c1905628-1905224 [Enterobacter cloacae complex sp.]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEMLPFPGMVEAHLASHPEDFIGGQWL
LVDINMKQFEGKVERINITIPRRLLVKIDSFVSEHPQFTNRSAFLAEAARRVLP
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEMLPFPGMVEAHLASHPEDFIGGQWL
LVDINMKQFEGKVERINITIPRRLLVKIDSFVSEHPQFTNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Q4AAS0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Q4AAR0 |