Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1132037..1132694 | Replicon | chromosome |
| Accession | NZ_LT991957 | ||
| Organism | Enterobacter cloacae complex sp. isolate C45 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A4V2LUM0 |
| Locus tag | DBR02_RS05750 | Protein ID | WP_063451987.1 |
| Coordinates | 1132037..1132447 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | DBR02_RS05755 | Protein ID | WP_003863437.1 |
| Coordinates | 1132428..1132694 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR02_RS05730 | 1128035..1129768 | - | 1734 | WP_063867895.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| DBR02_RS05735 | 1129774..1130487 | - | 714 | WP_063451984.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| DBR02_RS05740 | 1130516..1131412 | - | 897 | WP_063451985.1 | site-specific tyrosine recombinase XerD | - |
| DBR02_RS05745 | 1131514..1132035 | + | 522 | WP_107533681.1 | flavodoxin FldB | - |
| DBR02_RS05750 | 1132037..1132447 | - | 411 | WP_063451987.1 | protein YgfX | Toxin |
| DBR02_RS05755 | 1132428..1132694 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| DBR02_RS05760 | 1132988..1133968 | + | 981 | WP_107533682.1 | tRNA-modifying protein YgfZ | - |
| DBR02_RS05765 | 1134053..1134712 | - | 660 | WP_047729440.1 | hemolysin III family protein | - |
| DBR02_RS05770 | 1134979..1135710 | + | 732 | WP_107533683.1 | MurR/RpiR family transcriptional regulator | - |
| DBR02_RS05775 | 1135827..1137260 | + | 1434 | WP_107533684.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16277.13 Da Isoelectric Point: 11.4775
>T293992 WP_063451987.1 NZ_LT991957:c1132447-1132037 [Enterobacter cloacae complex sp.]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDAAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDAAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4V2LUM0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |