Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 105697..106223 | Replicon | plasmid pC309-p2 |
Accession | NZ_LT991956 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii isolate C309 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | DBR08_RS25190 | Protein ID | WP_000323025.1 |
Coordinates | 105936..106223 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J5W3H0 |
Locus tag | DBR08_RS25185 | Protein ID | WP_004196370.1 |
Coordinates | 105697..105936 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DBR08_RS25155 | 101034..101226 | - | 193 | Protein_116 | MFS transporter | - |
DBR08_RS25160 | 101256..102233 | + | 978 | WP_004196334.1 | chromate resistance protein | - |
DBR08_RS25165 | 102190..103566 | + | 1377 | WP_004196363.1 | chromate efflux transporter | - |
DBR08_RS25170 | 103597..104286 | - | 690 | WP_004196322.1 | hypothetical protein | - |
DBR08_RS25175 | 104300..105037 | - | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
DBR08_RS25180 | 105081..105446 | - | 366 | WP_009651956.1 | hypothetical protein | - |
DBR08_RS25185 | 105697..105936 | + | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
DBR08_RS25190 | 105936..106223 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
DBR08_RS25195 | 106290..107324 | - | 1035 | Protein_124 | IS481 family transposase | - |
DBR08_RS25200 | 107396..107554 | + | 159 | WP_013087178.1 | type I toxin-antitoxin system Hok family toxin | - |
DBR08_RS25205 | 108430..108744 | + | 315 | WP_044157807.1 | hypothetical protein | - |
DBR08_RS25210 | 108805..109266 | + | 462 | WP_013087181.1 | hypothetical protein | - |
DBR08_RS25215 | 109354..109554 | + | 201 | WP_013087182.1 | hypothetical protein | - |
DBR08_RS25220 | 109595..110386 | + | 792 | WP_013087183.1 | N-6 DNA methylase | - |
DBR08_RS25225 | 110428..110763 | + | 336 | WP_013087184.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..183339 | 183339 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T293989 WP_000323025.1 NZ_LT991956:105936-106223 [Enterobacter hormaechei subsp. steigerwaltii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|