Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 92356..93095 | Replicon | plasmid pC309-p2 |
Accession | NZ_LT991956 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii isolate C309 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A5E1AVR5 |
Locus tag | DBR08_RS25105 | Protein ID | WP_013087172.1 |
Coordinates | 92610..93095 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A5E1AWX8 |
Locus tag | DBR08_RS25100 | Protein ID | WP_012540086.1 |
Coordinates | 92356..92622 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DBR08_RS25070 | 87587..88123 | - | 537 | WP_013087166.1 | GNAT family N-acetyltransferase | - |
DBR08_RS25075 | 88248..89999 | - | 1752 | WP_162875198.1 | arsenical pump-driving ATPase | - |
DBR08_RS25080 | 90026..90388 | - | 363 | WP_013087168.1 | arsenic metallochaperone ArsD family protein | - |
DBR08_RS25085 | 90464..91009 | - | 546 | WP_013087169.1 | sigma-70 family RNA polymerase sigma factor | - |
DBR08_RS25090 | 91018..91731 | - | 714 | WP_013087170.1 | arsenical resistance protein ArsH | - |
DBR08_RS25095 | 91733..92056 | - | 324 | WP_013087171.1 | metalloregulator ArsR/SmtB family transcription factor | - |
DBR08_RS25100 | 92356..92622 | + | 267 | WP_012540086.1 | DUF1778 domain-containing protein | Antitoxin |
DBR08_RS25105 | 92610..93095 | + | 486 | WP_013087172.1 | GNAT family N-acetyltransferase | Toxin |
DBR08_RS25110 | 93513..94853 | + | 1341 | WP_004196353.1 | ISNCY family transposase | - |
DBR08_RS25120 | 95109..95531 | - | 423 | WP_032072095.1 | nickel resistance OB fold protein NcrY | - |
DBR08_RS25125 | 95693..96823 | - | 1131 | WP_004196366.1 | Ni(II)/Co(II) efflux transporter permease subunit NcrC | - |
DBR08_RS25130 | 96836..97105 | - | 270 | WP_004196355.1 | nickel-sensing transcriptional repressor NcrB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..183339 | 183339 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17810.62 Da Isoelectric Point: 9.8560
>T293988 WP_013087172.1 NZ_LT991956:92610-93095 [Enterobacter hormaechei subsp. steigerwaltii]
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E1AVR5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E1AWX8 |