Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 42047..42690 Replicon plasmid pC309-p2
Accession NZ_LT991956
Organism Enterobacter hormaechei subsp. steigerwaltii isolate C309

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag DBR08_RS24780 Protein ID WP_107591273.1
Coordinates 42047..42463 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag DBR08_RS24785 Protein ID WP_107591274.1
Coordinates 42460..42690 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DBR08_RS24760 38243..40237 - 1995 Protein_42 NERD domain-containing protein -
DBR08_RS24765 40381..40797 - 417 WP_107591272.1 type II toxin-antitoxin system VapC family toxin -
DBR08_RS24770 40794..41024 - 231 WP_024553479.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
DBR08_RS24775 41531..41857 - 327 WP_071789783.1 four-helix bundle copper-binding protein -
DBR08_RS24780 42047..42463 - 417 WP_107591273.1 type II toxin-antitoxin system VapC family toxin Toxin
DBR08_RS24785 42460..42690 - 231 WP_107591274.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
DBR08_RS24790 43643..44041 - 399 WP_063848683.1 hypothetical protein -
DBR08_RS24795 44196..44390 + 195 WP_045341885.1 hypothetical protein -
DBR08_RS24800 44444..45319 - 876 WP_045341886.1 hypothetical protein -
DBR08_RS24805 45769..46059 + 291 WP_013087126.1 hypothetical protein -
DBR08_RS24810 46190..46720 + 531 WP_063844250.1 hypothetical protein -
DBR08_RS24815 46739..47515 + 777 WP_063924172.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..183339 183339


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15182.62 Da        Isoelectric Point: 6.2225

>T293987 WP_107591273.1 NZ_LT991956:c42463-42047 [Enterobacter hormaechei subsp. steigerwaltii]
VNKIYMLDTCICSFIMREQPEAVLKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIELVDAFCARLDAIQPWDRA
AVDATTEIMVALRLAGTPIGPNDTAIAGHAIAVGAILVTNNTREFERVPGLVLEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8689.78 Da        Isoelectric Point: 4.3654

>AT293987 WP_107591274.1 NZ_LT991956:c42690-42460 [Enterobacter hormaechei subsp. steigerwaltii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVTDEGRVDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References