Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 42047..42690 | Replicon | plasmid pC309-p2 |
| Accession | NZ_LT991956 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii isolate C309 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | DBR08_RS24780 | Protein ID | WP_107591273.1 |
| Coordinates | 42047..42463 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | DBR08_RS24785 | Protein ID | WP_107591274.1 |
| Coordinates | 42460..42690 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR08_RS24760 | 38243..40237 | - | 1995 | Protein_42 | NERD domain-containing protein | - |
| DBR08_RS24765 | 40381..40797 | - | 417 | WP_107591272.1 | type II toxin-antitoxin system VapC family toxin | - |
| DBR08_RS24770 | 40794..41024 | - | 231 | WP_024553479.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| DBR08_RS24775 | 41531..41857 | - | 327 | WP_071789783.1 | four-helix bundle copper-binding protein | - |
| DBR08_RS24780 | 42047..42463 | - | 417 | WP_107591273.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DBR08_RS24785 | 42460..42690 | - | 231 | WP_107591274.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| DBR08_RS24790 | 43643..44041 | - | 399 | WP_063848683.1 | hypothetical protein | - |
| DBR08_RS24795 | 44196..44390 | + | 195 | WP_045341885.1 | hypothetical protein | - |
| DBR08_RS24800 | 44444..45319 | - | 876 | WP_045341886.1 | hypothetical protein | - |
| DBR08_RS24805 | 45769..46059 | + | 291 | WP_013087126.1 | hypothetical protein | - |
| DBR08_RS24810 | 46190..46720 | + | 531 | WP_063844250.1 | hypothetical protein | - |
| DBR08_RS24815 | 46739..47515 | + | 777 | WP_063924172.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..183339 | 183339 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15182.62 Da Isoelectric Point: 6.2225
>T293987 WP_107591273.1 NZ_LT991956:c42463-42047 [Enterobacter hormaechei subsp. steigerwaltii]
VNKIYMLDTCICSFIMREQPEAVLKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIELVDAFCARLDAIQPWDRA
AVDATTEIMVALRLAGTPIGPNDTAIAGHAIAVGAILVTNNTREFERVPGLVLEDWVN
VNKIYMLDTCICSFIMREQPEAVLKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIELVDAFCARLDAIQPWDRA
AVDATTEIMVALRLAGTPIGPNDTAIAGHAIAVGAILVTNNTREFERVPGLVLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|