Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 40381..41024 Replicon plasmid pC309-p2
Accession NZ_LT991956
Organism Enterobacter hormaechei subsp. steigerwaltii isolate C309

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag DBR08_RS24765 Protein ID WP_107591272.1
Coordinates 40381..40797 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A330D345
Locus tag DBR08_RS24770 Protein ID WP_024553479.1
Coordinates 40794..41024 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DBR08_RS24745 35822..36166 - 345 WP_045341877.1 hypothetical protein -
DBR08_RS24750 36666..36920 - 255 WP_045341878.1 hypothetical protein -
DBR08_RS24755 36965..37891 - 927 WP_045341879.1 hypothetical protein -
DBR08_RS24760 38243..40237 - 1995 Protein_42 NERD domain-containing protein -
DBR08_RS24765 40381..40797 - 417 WP_107591272.1 type II toxin-antitoxin system VapC family toxin Toxin
DBR08_RS24770 40794..41024 - 231 WP_024553479.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
DBR08_RS24775 41531..41857 - 327 WP_071789783.1 four-helix bundle copper-binding protein -
DBR08_RS24780 42047..42463 - 417 WP_107591273.1 type II toxin-antitoxin system VapC family toxin -
DBR08_RS24785 42460..42690 - 231 WP_107591274.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
DBR08_RS24790 43643..44041 - 399 WP_063848683.1 hypothetical protein -
DBR08_RS24795 44196..44390 + 195 WP_045341885.1 hypothetical protein -
DBR08_RS24800 44444..45319 - 876 WP_045341886.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..183339 183339


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15073.49 Da        Isoelectric Point: 6.4534

>T293986 WP_107591272.1 NZ_LT991956:c40797-40381 [Enterobacter hormaechei subsp. steigerwaltii]
VNKIYMLDTCICSFIMREQPEAVLKRLEQAVLRNHRIVVSAITYAEMRFGATGPKASPRHIELVDAFCARLDAIQPWDRA
AVDATTEIMVALRLAGTPIGPNDTAIAGNAIAAGAVLVTNNTREFARVPGLILEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8663.74 Da        Isoelectric Point: 4.3654

>AT293986 WP_024553479.1 NZ_LT991956:c41024-40794 [Enterobacter hormaechei subsp. steigerwaltii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADADFMAEREDVVTDEGRVDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A330D345

References