Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 33663..34300 Replicon plasmid pC309-p2
Accession NZ_LT991956
Organism Enterobacter hormaechei subsp. steigerwaltii isolate C309

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag DBR08_RS24725 Protein ID WP_045341875.1
Coordinates 33663..34073 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID H9AC95
Locus tag DBR08_RS24730 Protein ID WP_001261283.1
Coordinates 34070..34300 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DBR08_RS24690 29019..30704 - 1686 WP_000209296.1 mercury(II) reductase -
DBR08_RS24695 30833..31258 - 426 WP_000522996.1 organomercurial transporter MerC -
DBR08_RS24700 31286..31561 - 276 WP_000732275.1 mercury resistance system periplasmic binding protein MerP -
DBR08_RS24705 31577..31972 - 396 WP_001294653.1 mercuric ion transporter MerT -
DBR08_RS24710 32044..32499 + 456 WP_001166628.1 Hg(II)-responsive transcriptional regulator -
DBR08_RS24715 32534..32749 + 216 Protein_34 alpha/beta hydrolase -
DBR08_RS24720 32924..33457 - 534 WP_052686581.1 hypothetical protein -
DBR08_RS24725 33663..34073 - 411 WP_045341875.1 PIN domain-containing protein Toxin
DBR08_RS24730 34070..34300 - 231 WP_001261283.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
DBR08_RS24740 34677..35678 + 1002 WP_045341876.1 DUF4238 domain-containing protein -
DBR08_RS24745 35822..36166 - 345 WP_045341877.1 hypothetical protein -
DBR08_RS24750 36666..36920 - 255 WP_045341878.1 hypothetical protein -
DBR08_RS24755 36965..37891 - 927 WP_045341879.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..183339 183339


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-127)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14277.57 Da        Isoelectric Point: 5.7223

>T293985 WP_045341875.1 NZ_LT991956:c34073-33663 [Enterobacter hormaechei subsp. steigerwaltii]
MKKTYMLDTGICAHILREQPAALLKRLEQAVLAGDRIVVPAITWAEISLAARESGPAAQLLADAFAARLDAILPWDRAAV
DATTDVRVALRLAGTSIGPNDTAIAGHAIAAGAVLVTGKGGEFERVPGLVLEDWVK

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8737.83 Da        Isoelectric Point: 4.3775

>AT293985 WP_001261283.1 NZ_LT991956:c34300-34070 [Enterobacter hormaechei subsp. steigerwaltii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6X6R7C5

References