Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 196242..196768 | Replicon | plasmid pC309-VIM4 |
| Accession | NZ_LT991955 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii isolate C309 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | DBR08_RS24175 | Protein ID | WP_000323025.1 |
| Coordinates | 196242..196529 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | DBR08_RS24180 | Protein ID | WP_000534858.1 |
| Coordinates | 196529..196768 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR08_RS25795 | 191812..191988 | - | 177 | WP_001371930.1 | hypothetical protein | - |
| DBR08_RS24145 | 192499..193443 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
| DBR08_RS24150 | 193542..194141 | + | 600 | WP_001031420.1 | hypothetical protein | - |
| DBR08_RS24155 | 194201..194551 | + | 351 | WP_000743059.1 | hypothetical protein | - |
| DBR08_RS24160 | 194598..194801 | + | 204 | WP_001015183.1 | hypothetical protein | - |
| DBR08_RS24165 | 195083..195403 | + | 321 | WP_000332796.1 | hypothetical protein | - |
| DBR08_RS24170 | 196012..196170 | - | 159 | WP_001447866.1 | type I toxin-antitoxin system Hok family toxin | - |
| DBR08_RS24175 | 196242..196529 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| DBR08_RS24180 | 196529..196768 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| DBR08_RS24190 | 197031..197954 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| DBR08_RS24195 | 198154..198726 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| DBR08_RS24200 | 199202..200440 | - | 1239 | WP_000219087.1 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaVIM-4 / aac(6')-Il / dfrA1 / aadA1 / qacE / sul1 | - | 1..254277 | 254277 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T293984 WP_000323025.1 NZ_LT991955:c196529-196242 [Enterobacter hormaechei subsp. steigerwaltii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|