Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3088620..3089359 | Replicon | chromosome |
Accession | NZ_LT991954 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii isolate C309 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
Locus tag | DBR08_RS15035 | Protein ID | WP_003857133.1 |
Coordinates | 3088620..3089105 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | DBR08_RS15040 | Protein ID | WP_003857131.1 |
Coordinates | 3089093..3089359 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DBR08_RS15000 | 3084118..3084732 | + | 615 | WP_080337195.1 | NUDIX hydrolase | - |
DBR08_RS15005 | 3084916..3085551 | - | 636 | WP_015570517.1 | DUF421 domain-containing protein | - |
DBR08_RS15010 | 3085561..3086007 | - | 447 | WP_014069654.1 | DUF3290 domain-containing protein | - |
DBR08_RS15020 | 3086436..3086764 | - | 329 | Protein_2834 | helix-turn-helix domain-containing protein | - |
DBR08_RS15025 | 3087019..3087984 | + | 966 | WP_045338503.1 | hypothetical protein | - |
DBR08_RS15030 | 3088000..3088569 | + | 570 | WP_017382346.1 | hypothetical protein | - |
DBR08_RS15035 | 3088620..3089105 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
DBR08_RS15040 | 3089093..3089359 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
DBR08_RS15045 | 3089423..3090352 | - | 930 | WP_026080525.1 | LysR family transcriptional regulator | - |
DBR08_RS15050 | 3090482..3091870 | + | 1389 | WP_017382343.1 | MFS transporter | - |
DBR08_RS15055 | 3091893..3092888 | - | 996 | WP_017382342.1 | DUF2891 domain-containing protein | - |
DBR08_RS15060 | 3092898..3093884 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T293975 WP_003857133.1 NZ_LT991954:c3089105-3088620 [Enterobacter hormaechei subsp. steigerwaltii]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L9PBP9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FCR9 |