Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1941417..1942037 Replicon chromosome
Accession NZ_LT991954
Organism Enterobacter hormaechei subsp. steigerwaltii isolate C309

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag DBR08_RS09470 Protein ID WP_015571250.1
Coordinates 1941417..1941635 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag DBR08_RS09475 Protein ID WP_006809850.1
Coordinates 1941663..1942037 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DBR08_RS09440 1937429..1937689 + 261 WP_015571255.1 type B 50S ribosomal protein L31 -
DBR08_RS09445 1937692..1937832 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
DBR08_RS09450 1937829..1938539 - 711 WP_017383207.1 GNAT family N-acetyltransferase -
DBR08_RS09455 1938641..1940101 + 1461 WP_017383208.1 PLP-dependent aminotransferase family protein -
DBR08_RS09460 1940073..1940540 - 468 WP_017383209.1 membrane protein -
DBR08_RS09465 1940657..1941208 - 552 WP_017383210.1 maltose O-acetyltransferase -
DBR08_RS09470 1941417..1941635 - 219 WP_015571250.1 hemolysin expression modulator Hha Toxin
DBR08_RS09475 1941663..1942037 - 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
DBR08_RS09480 1942548..1945694 - 3147 WP_015571248.1 multidrug efflux RND transporter permease subunit -
DBR08_RS09485 1945717..1946910 - 1194 WP_017694395.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T293974 WP_015571250.1 NZ_LT991954:c1941635-1941417 [Enterobacter hormaechei subsp. steigerwaltii]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT293974 WP_006809850.1 NZ_LT991954:c1942037-1941663 [Enterobacter hormaechei subsp. steigerwaltii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References