Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 774719..775335 | Replicon | chromosome |
| Accession | NZ_LT991954 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii isolate C309 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | DBR08_RS03850 | Protein ID | WP_017382676.1 |
| Coordinates | 774719..775090 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | DBR08_RS03855 | Protein ID | WP_015569912.1 |
| Coordinates | 775093..775335 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR08_RS03835 | 772219..773121 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| DBR08_RS03840 | 773118..773753 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| DBR08_RS03845 | 773750..774679 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| DBR08_RS03850 | 774719..775090 | - | 372 | WP_017382676.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DBR08_RS03855 | 775093..775335 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| DBR08_RS03860 | 775534..776454 | + | 921 | WP_017382675.1 | alpha/beta hydrolase | - |
| DBR08_RS03865 | 776463..777404 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| DBR08_RS03870 | 777449..777886 | - | 438 | WP_015569909.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| DBR08_RS03875 | 777883..778764 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| DBR08_RS03880 | 778758..779357 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
| DBR08_RS03885 | 779476..780276 | - | 801 | WP_017382673.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13737.88 Da Isoelectric Point: 6.4882
>T293973 WP_017382676.1 NZ_LT991954:c775090-774719 [Enterobacter hormaechei subsp. steigerwaltii]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|