Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 646085..646692 | Replicon | chromosome |
| Accession | NZ_LT991954 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii isolate C309 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | DBR08_RS03245 | Protein ID | WP_017382585.1 |
| Coordinates | 646507..646692 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | DBR08_RS03240 | Protein ID | WP_017382586.1 |
| Coordinates | 646085..646492 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DBR08_RS03210 | 641931..642584 | + | 654 | WP_017382590.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| DBR08_RS03215 | 642587..643447 | + | 861 | WP_017382589.1 | L-ribulose-5-phosphate 3-epimerase | - |
| DBR08_RS03220 | 643441..644136 | + | 696 | WP_017382588.1 | L-ribulose-5-phosphate 4-epimerase | - |
| DBR08_RS03225 | 644137..644424 | - | 288 | Protein_604 | helix-turn-helix domain-containing protein | - |
| DBR08_RS03230 | 644431..644799 | + | 369 | Protein_605 | glycoside hydrolase family 127 protein | - |
| DBR08_RS03235 | 645006..646081 | + | 1076 | Protein_606 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| DBR08_RS03240 | 646085..646492 | - | 408 | WP_017382586.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| DBR08_RS03245 | 646507..646692 | - | 186 | WP_017382585.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| DBR08_RS03250 | 646942..648480 | - | 1539 | WP_006808612.1 | aldehyde dehydrogenase AldB | - |
| DBR08_RS03255 | 648647..649531 | + | 885 | WP_017382584.1 | ROK family protein | - |
| DBR08_RS03260 | 649535..651373 | - | 1839 | WP_017382583.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6794.98 Da Isoelectric Point: 11.4624
>T293972 WP_017382585.1 NZ_LT991954:c646692-646507 [Enterobacter hormaechei subsp. steigerwaltii]
VKSADIIAVLVSHGWKCVRTTGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIIAVLVSHGWKCVRTTGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15171.94 Da Isoelectric Point: 4.3197
>AT293972 WP_017382586.1 NZ_LT991954:c646492-646085 [Enterobacter hormaechei subsp. steigerwaltii]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEAFPLPGNVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPR
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEAFPLPGNVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPR
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|