Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapB(antitoxin)
Location 20479..21053 Replicon plasmid PP4
Accession NZ_LT985195
Organism Pseudomonas syringae strain CFBP 2116

Toxin (Protein)


Gene name vapC Uniprot ID Q48BC5
Locus tag DTQ61_RS30120 Protein ID WP_003344395.1
Coordinates 20479..20856 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q48BC4
Locus tag DTQ61_RS30125 Protein ID WP_004644067.1
Coordinates 20853..21053 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DTQ61_RS30100 15695..16273 + 579 WP_004642775.1 conjugal transfer protein TraX -
DTQ61_RS30105 16404..18548 + 2145 WP_060404099.1 DotA/TraY family protein -
DTQ61_RS30110 18535..19194 + 660 WP_044424882.1 plasmid IncI1-type surface exclusion protein ExcA -
DTQ61_RS30115 19287..20489 + 1203 WP_044424879.1 hypothetical protein -
DTQ61_RS30120 20479..20856 - 378 WP_003344395.1 PIN domain-containing protein Toxin
DTQ61_RS30125 20853..21053 - 201 WP_004644067.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
DTQ61_RS30130 21146..22231 + 1086 WP_060404100.1 thioredoxin fold domain-containing protein -
DTQ61_RS30135 22218..23948 + 1731 Protein_21 TraM recognition domain-containing protein -
DTQ61_RS30140 24270..24698 + 429 WP_007253364.1 GntR family transcriptional regulator -
DTQ61_RS30145 24787..25107 + 321 WP_111780225.1 hypothetical protein -
DTQ61_RS30150 25117..25554 + 438 WP_111780226.1 hypothetical protein -
DTQ61_RS30155 25570..25779 + 210 WP_111780227.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..82845 82845


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-113)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-43)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13633.73 Da        Isoelectric Point: 6.4723

>T293970 WP_003344395.1 NZ_LT985195:c20856-20479 [Pseudomonas syringae]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH

Download         Length: 378 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7445.66 Da        Isoelectric Point: 7.0102

>AT293970 WP_004644067.1 NZ_LT985195:c21053-20853 [Pseudomonas syringae]
MRTTVTIDDALYQRALEVADPAMDKADLFREAVQTFVRIQAAKRLMALGATLPTMEDIARRHEKAL

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B3GPE2

Antitoxin

Source ID Structure
AlphaFold DB A0A2S4IKB9

References