Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 45558..46194 | Replicon | plasmid PP3 |
Accession | NZ_LT985194 | ||
Organism | Pseudomonas syringae strain CFBP 2116 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2S4IFM0 |
Locus tag | DTQ61_RS29760 | Protein ID | WP_044310977.1 |
Coordinates | 45558..45740 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A2S4IFN3 |
Locus tag | DTQ61_RS29765 | Protein ID | WP_060404204.1 |
Coordinates | 45772..46194 (+) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DTQ61_RS29735 | 42011..43240 | - | 1230 | WP_104721077.1 | IS91 family transposase | - |
DTQ61_RS29740 | 43221..43502 | - | 282 | WP_060407302.1 | hypothetical protein | - |
DTQ61_RS29750 | 43776..45002 | - | 1227 | WP_104721076.1 | IS91 family transposase | - |
DTQ61_RS29760 | 45558..45740 | + | 183 | WP_044310977.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
DTQ61_RS29765 | 45772..46194 | + | 423 | WP_060404204.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
DTQ61_RS29770 | 46360..46671 | + | 312 | Protein_52 | hypothetical protein | - |
DTQ61_RS29775 | 46703..49729 | - | 3027 | WP_060404205.1 | Tn3-like element ISPsy30 family transposase | - |
DTQ61_RS29780 | 49719..50315 | - | 597 | WP_057425230.1 | recombinase family protein | - |
DTQ61_RS31005 | 50632..51162 | - | 531 | WP_005752338.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..83816 | 83816 | |
- | inside | IScluster/Tn | - | - | 37991..58188 | 20197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6836.96 Da Isoelectric Point: 10.5498
>T293969 WP_044310977.1 NZ_LT985194:45558-45740 [Pseudomonas syringae]
MKCSEFRRWLQAQGAEFKAAKGSHFKVYLNGKATIFADHGSKEMHEGLRKTIIKQLGLKD
MKCSEFRRWLQAQGAEFKAAKGSHFKVYLNGKATIFADHGSKEMHEGLRKTIIKQLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15616.00 Da Isoelectric Point: 5.1895
>AT293969 WP_060404204.1 NZ_LT985194:45772-46194 [Pseudomonas syringae]
MYQYPLTQHQEQTGVWLSCPNIPEMNASGETLTEALDEALNGMESALSLYVDQRRKIPQASLPVGDELVMHLPALTVAKI
MLWNSMLDNGVSRAELARRLGCTRQVVDRLVDFLHTSKIEQVERALGLLGRRITLSLEAA
MYQYPLTQHQEQTGVWLSCPNIPEMNASGETLTEALDEALNGMESALSLYVDQRRKIPQASLPVGDELVMHLPALTVAKI
MLWNSMLDNGVSRAELARRLGCTRQVVDRLVDFLHTSKIEQVERALGLLGRRITLSLEAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4IFM0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4IFN3 |