293967

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 6749..7196 Replicon plasmid PP2
Accession NZ_LT985193
Organism Pseudomonas syringae strain CFBP 2116

Toxin (Protein)


Gene name relE Uniprot ID A0A3M4C5F0
Locus tag DTQ61_RS29130 Protein ID WP_003348606.1
Coordinates 6924..7196 (+) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A3M4C5H0
Locus tag DTQ61_RS29125 Protein ID WP_005730485.1
Coordinates 6749..6934 (+) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DTQ61_RS29090 2408..2703 - 296 Protein_1 DDE-type integrase/transposase/recombinase -
DTQ61_RS29095 2964..3404 + 441 WP_044319945.1 hypothetical protein -
DTQ61_RS29100 3803..4318 + 516 WP_031598251.1 GAF domain-containing protein -
DTQ61_RS29105 4643..5173 + 531 WP_031598249.1 hypothetical protein -
DTQ61_RS29110 5275..5556 - 282 Protein_5 tyrosine-type recombinase/integrase -
DTQ61_RS29115 5800..6327 + 528 Protein_6 recombinase family protein -
DTQ61_RS29120 6420..6698 + 279 WP_053479513.1 hypothetical protein -
DTQ61_RS29125 6749..6934 + 186 WP_005730485.1 hypothetical protein Antitoxin
DTQ61_RS29130 6924..7196 + 273 WP_003348606.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DTQ61_RS29135 7407..8120 + 714 WP_053479514.1 UPF0149 family protein -
DTQ61_RS29140 8225..8556 - 332 Protein_11 Tn3 family transposase -
DTQ61_RS29145 8554..8766 - 213 Protein_12 DUF4158 domain-containing protein -
DTQ61_RS29150 8770..8958 - 189 Protein_13 helix-turn-helix domain-containing protein -
DTQ61_RS29155 8997..9818 - 822 WP_005735297.1 C58 family peptidase -
DTQ61_RS29160 10147..11085 + 939 Protein_15 DNA cytosine methyltransferase -
DTQ61_RS29165 11178..11459 + 282 WP_015062535.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..61361 61361
- flank IS/Tn - - 11461..12669 1208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10199.67 Da        Isoelectric Point: 5.0749

>T293967 WP_003348606.1 NZ_LT985193:6924-7196 [Pseudomonas syringae]
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIL
DVLHARQEYP

Download         Length: 273 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7292.18 Da        Isoelectric Point: 7.2040

>AT293967 WP_005730485.1 NZ_LT985193:6749-6934 [Pseudomonas syringae]
MSIQLDPRVSEFETQEQADNYDRWFRQRIEHSLADPRPPVPHDEAMARVRAMIEAKRRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3M4C5F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3M4C5H0

References