Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 5774661..5775180 | Replicon | chromosome |
Accession | NZ_LT985192 | ||
Organism | Pseudomonas syringae strain CFBP 2116 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q48Q48 |
Locus tag | DTQ61_RS27865 | Protein ID | WP_002551445.1 |
Coordinates | 5774661..5774951 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S6UWW5 |
Locus tag | DTQ61_RS27870 | Protein ID | WP_002551444.1 |
Coordinates | 5774941..5775180 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DTQ61_RS27835 | 5770085..5770888 | - | 804 | WP_003417182.1 | IS21-like element ISPsy20 family helper ATPase IstB | - |
DTQ61_RS27840 | 5770881..5772380 | - | 1500 | WP_103356851.1 | IS21 family transposase | - |
DTQ61_RS27850 | 5772963..5773385 | + | 423 | WP_005746664.1 | DUF1493 family protein | - |
DTQ61_RS27855 | 5773691..5774428 | + | 738 | WP_060403416.1 | hypothetical protein | - |
DTQ61_RS27865 | 5774661..5774951 | - | 291 | WP_002551445.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DTQ61_RS27870 | 5774941..5775180 | - | 240 | WP_002551444.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
DTQ61_RS27875 | 5775344..5775817 | - | 474 | WP_002551443.1 | GNAT family N-acetyltransferase | - |
DTQ61_RS27880 | 5775919..5776467 | - | 549 | WP_044318253.1 | GNAT family N-acetyltransferase | - |
DTQ61_RS27885 | 5776627..5777121 | + | 495 | WP_004667254.1 | hypothetical protein | - |
DTQ61_RS27890 | 5777155..5778429 | - | 1275 | WP_004667253.1 | OprD family porin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11316.19 Da Isoelectric Point: 10.2579
>T293966 WP_002551445.1 NZ_LT985192:c5774951-5774661 [Pseudomonas syringae]
MTYNLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
REREEVYRKATDRLGR
MTYNLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
REREEVYRKATDRLGR
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G4DBS4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K8M1G9 |