Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 156744..157324 | Replicon | chromosome |
Accession | NZ_LT985192 | ||
Organism | Pseudomonas syringae strain CFBP 2116 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A2G4CV40 |
Locus tag | DTQ61_RS00815 | Protein ID | WP_044322659.1 |
Coordinates | 157025..157324 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A2G4CUT8 |
Locus tag | DTQ61_RS00810 | Protein ID | WP_003407168.1 |
Coordinates | 156744..157028 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DTQ61_RS00790 | 152018..153052 | + | 1035 | WP_057427112.1 | IS110 family transposase | - |
DTQ61_RS00795 | 153509..154527 | - | 1019 | Protein_139 | tyrosine protein phosphatase | - |
DTQ61_RS00800 | 154953..155987 | + | 1035 | WP_057427112.1 | IS110 family transposase | - |
DTQ61_RS00805 | 156361..156669 | + | 309 | WP_180275929.1 | DUF4113 domain-containing protein | - |
DTQ61_RS00810 | 156744..157028 | - | 285 | WP_003407168.1 | putative addiction module antidote protein | Antitoxin |
DTQ61_RS00815 | 157025..157324 | - | 300 | WP_044322659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DTQ61_RS00825 | 157926..158342 | + | 417 | WP_060403106.1 | hypothetical protein | - |
DTQ61_RS00835 | 158738..159391 | + | 654 | WP_060403115.1 | AAA family ATPase | - |
DTQ61_RS00840 | 159480..159731 | + | 252 | WP_003348789.1 | ribbon-helix-helix protein, CopG family | - |
DTQ61_RS00845 | 159996..160637 | + | 642 | WP_060403107.1 | SOS response-associated peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 111390..159731 | 48341 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11170.80 Da Isoelectric Point: 9.9231
>T293965 WP_044322659.1 NZ_LT985192:c157324-157025 [Pseudomonas syringae]
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKKLADQWWQE
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKKLADQWWQE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G4CV40 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G4CUT8 |