Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
| Location | 135132..135743 | Replicon | chromosome |
| Accession | NZ_LT985192 | ||
| Organism | Pseudomonas syringae strain CFBP 2116 | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | A0A2G4CXS4 |
| Locus tag | DTQ61_RS00725 | Protein ID | WP_057456423.1 |
| Coordinates | 135393..135743 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | - |
| Locus tag | DTQ61_RS00720 | Protein ID | WP_057432311.1 |
| Coordinates | 135132..135380 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DTQ61_RS00705 | 130981..132900 | + | 1920 | WP_060403782.1 | response regulator | - |
| DTQ61_RS00710 | 133314..133646 | + | 333 | WP_060403781.1 | hypothetical protein | - |
| DTQ61_RS00715 | 133831..134793 | - | 963 | WP_060403780.1 | tyrosine-type recombinase/integrase | - |
| DTQ61_RS00720 | 135132..135380 | + | 249 | WP_057432311.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| DTQ61_RS00725 | 135393..135743 | + | 351 | WP_057456423.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DTQ61_RS00730 | 135850..136254 | - | 405 | WP_057456424.1 | hypothetical protein | - |
| DTQ61_RS00735 | 136244..139066 | - | 2823 | WP_060403779.1 | RHS repeat protein | - |
| DTQ61_RS00740 | 139063..139854 | - | 792 | WP_057431753.1 | RHS repeat protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 111390..159731 | 48341 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12901.70 Da Isoelectric Point: 4.1824
>T293964 WP_057456423.1 NZ_LT985192:135393-135743 [Pseudomonas syringae]
MNTFALRFTDLAQQSLEDQVEHLAVTQGFSSAAQRIDSLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPI
MNTFALRFTDLAQQSLEDQVEHLAVTQGFSSAAQRIDSLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|