Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2772789..2773341 | Replicon | chromosome |
| Accession | NZ_LT985188 | ||
| Organism | Micropruina glycogenica isolate | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | MPLG2_RS13005 | Protein ID | WP_105186500.1 |
| Coordinates | 2772789..2773106 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | MPLG2_RS13010 | Protein ID | WP_105187664.1 |
| Coordinates | 2773108..2773341 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPLG2_RS12980 | 2768115..2769584 | - | 1470 | WP_105186496.1 | DNA-3-methyladenine glycosylase 2 family protein | - |
| MPLG2_RS12985 | 2769758..2770678 | - | 921 | WP_105186497.1 | phosphotransferase | - |
| MPLG2_RS19060 | 2771076..2771297 | + | 222 | WP_197709940.1 | hypothetical protein | - |
| MPLG2_RS12995 | 2771365..2771913 | - | 549 | WP_105186498.1 | DUF1905 domain-containing protein | - |
| MPLG2_RS13000 | 2771967..2772467 | + | 501 | WP_105186499.1 | DinB family protein | - |
| MPLG2_RS13005 | 2772789..2773106 | - | 318 | WP_105186500.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| MPLG2_RS13010 | 2773108..2773341 | - | 234 | WP_105187664.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| MPLG2_RS13020 | 2773577..2776048 | - | 2472 | WP_105186501.1 | ATP-dependent DNA ligase | - |
| MPLG2_RS13025 | 2776095..2776553 | + | 459 | WP_105187665.1 | YdeI/OmpD-associated family protein | - |
| MPLG2_RS13030 | 2777124..2777957 | + | 834 | WP_105186502.1 | CPBP family intramembrane metalloprotease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11188.09 Da Isoelectric Point: 4.7247
>T293962 WP_105186500.1 NZ_LT985188:c2773106-2772789 [Micropruina glycogenica]
VREICLARLDKTRPVVVLTREAARAAMTKVTVAPITSTIKGLNSEVSVGPDNGLEQLSVISLDNVVTIPANLLGRTVGFL
SSEQEMLLAKAIVLAYDLDIALLDT
VREICLARLDKTRPVVVLTREAARAAMTKVTVAPITSTIKGLNSEVSVGPDNGLEQLSVISLDNVVTIPANLLGRTVGFL
SSEQEMLLAKAIVLAYDLDIALLDT
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|