Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1775867..1776432 | Replicon | chromosome |
| Accession | NZ_LT985188 | ||
| Organism | Micropruina glycogenica isolate | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | MPLG2_RS08250 | Protein ID | WP_173909653.1 |
| Coordinates | 1776082..1776432 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | MPLG2_RS08245 | Protein ID | WP_173909652.1 |
| Coordinates | 1775867..1776085 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPLG2_RS08210 | 1771186..1771794 | + | 609 | WP_105185707.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| MPLG2_RS08215 | 1771822..1773102 | - | 1281 | WP_197709915.1 | DDE-type integrase/transposase/recombinase | - |
| MPLG2_RS08225 | 1773564..1773752 | + | 189 | WP_105185708.1 | hypothetical protein | - |
| MPLG2_RS08230 | 1773736..1774623 | + | 888 | WP_105185709.1 | site-specific integrase | - |
| MPLG2_RS08235 | 1774655..1774852 | - | 198 | WP_105185710.1 | helix-turn-helix domain-containing protein | - |
| MPLG2_RS08240 | 1774843..1775013 | - | 171 | WP_158680984.1 | hypothetical protein | - |
| MPLG2_RS08245 | 1775867..1776085 | + | 219 | WP_173909652.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| MPLG2_RS08250 | 1776082..1776432 | + | 351 | WP_173909653.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| MPLG2_RS08260 | 1777024..1777362 | - | 339 | WP_105185714.1 | hypothetical protein | - |
| MPLG2_RS08265 | 1777487..1778434 | - | 948 | WP_105185715.1 | hypothetical protein | - |
| MPLG2_RS08270 | 1778436..1778981 | - | 546 | WP_105185429.1 | sigma-70 family RNA polymerase sigma factor | - |
| MPLG2_RS08275 | 1780277..1780687 | + | 411 | WP_197710121.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1774843..1784142 | 9299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12653.69 Da Isoelectric Point: 11.1582
>T293961 WP_173909653.1 NZ_LT985188:1776082-1776432 [Micropruina glycogenica]
MMLRGEIRLTDLDPARAAEADTRRPAIIVSNDRANATAARLGRGVVTVVPITSNISRVFPFQVLLPADDVGIRVDSKAQA
EQVRSVSIERIGPVIGRLPTHLISKLDDALRLHLQL
MMLRGEIRLTDLDPARAAEADTRRPAIIVSNDRANATAARLGRGVVTVVPITSNISRVFPFQVLLPADDVGIRVDSKAQA
EQVRSVSIERIGPVIGRLPTHLISKLDDALRLHLQL
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|