Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-yefM/YoeB-RelB
Location 962508..963031 Replicon chromosome
Accession NZ_LT985188
Organism Micropruina glycogenica isolate

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag MPLG2_RS04500 Protein ID WP_105185109.1
Coordinates 962771..963031 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag MPLG2_RS04495 Protein ID WP_105185108.1
Coordinates 962508..962774 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MPLG2_RS04460 957987..958328 - 342 WP_197710081.1 type II toxin-antitoxin system VapB family antitoxin -
MPLG2_RS04465 958370..958984 + 615 WP_105185104.1 dihydrofolate reductase family protein -
MPLG2_RS04470 958988..959359 + 372 WP_105185105.1 hypothetical protein -
MPLG2_RS04475 959356..960288 + 933 WP_197710082.1 hypothetical protein -
MPLG2_RS18945 960299..960523 + 225 WP_197710083.1 hypothetical protein -
MPLG2_RS18950 960520..960759 - 240 WP_197710084.1 carbohydrate ABC transporter permease -
MPLG2_RS04485 960932..961168 + 237 WP_105185106.1 toxin-antitoxin system antitoxin subunit -
MPLG2_RS04490 961165..961581 + 417 WP_105185107.1 type II toxin-antitoxin system VapC family toxin -
MPLG2_RS04495 962508..962774 + 267 WP_105185108.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
MPLG2_RS04500 962771..963031 + 261 WP_105185109.1 Txe/YoeB family addiction module toxin Toxin
MPLG2_RS04505 963070..963303 + 234 WP_105185110.1 toxin-antitoxin system antitoxin subunit -
MPLG2_RS04510 963375..964364 + 990 WP_105185111.1 IS5 family transposase -
MPLG2_RS04515 964721..966304 - 1584 WP_105185112.1 IS1182 family transposase -
MPLG2_RS04520 966394..966984 - 591 WP_105185113.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 932844..982477 49633


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-68)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10121.50 Da        Isoelectric Point: 8.4340

>T293959 WP_105185109.1 NZ_LT985188:962771-963031 [Micropruina glycogenica]
VNLAFTPTGWDDLNYWADRDRATYKKVRVLLKEVVRTPFEGTGKPEPLKYQLGNVWSRRITQEHRLVYAVEDEQIVVLAA
RFHYGE

Download         Length: 261 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9723.70 Da        Isoelectric Point: 4.3422

>AT293959 WP_105185108.1 NZ_LT985188:962508-962774 [Micropruina glycogenica]
MSTMSASEARKNLFPLLGQVNEDHDVVRITSKAGNAVLISEADYEAWQTTRHLFSTPANARRLLGSIQEWHDGNLVTEAL
PEDAEGDE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References