Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 937468..937999 | Replicon | chromosome |
Accession | NZ_LT984798 | ||
Organism | Desulfovibrio sp. G11 isolate G11PacBio |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A807ZMP4 |
Locus tag | DSVG11_RS04115 | Protein ID | WP_072311512.1 |
Coordinates | 937468..937764 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A7W8FFT7 |
Locus tag | DSVG11_RS04120 | Protein ID | WP_072311511.1 |
Coordinates | 937754..937999 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DSVG11_RS04095 | 932862..933029 | - | 168 | WP_096152722.1 | hypothetical protein | - |
DSVG11_RS04100 | 933286..934914 | - | 1629 | WP_072311513.1 | VWA domain-containing protein | - |
DSVG11_RS04105 | 934919..935956 | - | 1038 | WP_096152721.1 | DUF3150 domain-containing protein | - |
DSVG11_RS04110 | 935966..937318 | - | 1353 | WP_072311531.1 | AAA family ATPase | - |
DSVG11_RS04115 | 937468..937764 | - | 297 | WP_072311512.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DSVG11_RS04120 | 937754..937999 | - | 246 | WP_072311511.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
DSVG11_RS04125 | 938128..939291 | - | 1164 | WP_072311510.1 | hypothetical protein | - |
DSVG11_RS04130 | 939360..940061 | - | 702 | WP_072311509.1 | ERF family protein | - |
DSVG11_RS04135 | 940232..940492 | - | 261 | WP_072311508.1 | Txe/YoeB family addiction module toxin | - |
DSVG11_RS04140 | 940473..940745 | - | 273 | WP_072311507.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
DSVG11_RS04145 | 940857..941720 | - | 864 | WP_096152720.1 | restriction endonuclease | - |
DSVG11_RS04150 | 941735..942688 | - | 954 | WP_143142576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 932862..945194 | 12332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11615.64 Da Isoelectric Point: 10.2579
>T293957 WP_072311512.1 NZ_LT984798:c937764-937468 [Desulfovibrio sp. G11]
MSYSLQFHEIALKEWRKLDASIREQFKKKLAERLEHPRVPSSALSGMRDCYKIKLRSIGYRLVYMVDDGILFVTVISIGK
RERLEVYRKALQRVTPEE
MSYSLQFHEIALKEWRKLDASIREQFKKKLAERLEHPRVPSSALSGMRDCYKIKLRSIGYRLVYMVDDGILFVTVISIGK
RERLEVYRKALQRVTPEE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A807ZMP4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W8FFT7 |