Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) chpB-mazE/PRK09812-ChpS
Location 123720..124315 Replicon plasmid RW109 plasmid 2
Accession NZ_LT969521
Organism Pseudomonas aeruginosa isolate RW109

Toxin (Protein)


Gene name chpB Uniprot ID A0A2K4Y2Z0
Locus tag RW109_RS37955 Protein ID WP_023100676.1
Coordinates 123720..124070 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A2K4Y2Y6
Locus tag RW109_RS37960 Protein ID WP_023100677.1
Coordinates 124067..124315 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RW109_RS37915 120199..120534 - 336 WP_019719038.1 IS66 family insertion sequence element accessory protein TnpB -
RW109_RS37920 120531..120899 - 369 WP_078451037.1 IS66 family insertion sequence hypothetical protein -
RW109_RS37925 121212..121475 + 264 WP_020303033.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
RW109_RS37930 121462..121743 + 282 WP_023100672.1 type II toxin-antitoxin system YafQ family toxin -
RW109_RS37935 121780..122115 + 336 WP_023100673.1 hypothetical protein -
RW109_RS37945 122497..122949 + 453 WP_023100674.1 hypothetical protein -
RW109_RS37950 122998..123720 - 723 WP_031634065.1 hypothetical protein -
RW109_RS37955 123720..124070 - 351 WP_023100676.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
RW109_RS37960 124067..124315 - 249 WP_023100677.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
RW109_RS38330 124312..124731 - 420 WP_041167413.1 hypothetical protein -
RW109_RS37965 124851..125327 - 477 WP_023100690.1 single-stranded DNA-binding protein -
RW109_RS37970 125338..125775 - 438 WP_023100689.1 hypothetical protein -
RW109_RS37975 125784..126467 - 684 WP_023100688.1 hypothetical protein -
RW109_RS37980 126464..127000 - 537 WP_023100687.1 hypothetical protein -
RW109_RS37985 126997..127227 - 231 WP_023100686.1 hypothetical protein -
RW109_RS37990 127217..129286 - 2070 WP_023100685.1 DNA cytosine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..151612 151612


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(11-112)

Antitoxin

Antitoxin PemI-like

(1-81)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12073.06 Da        Isoelectric Point: 10.1005

>T293955 WP_023100676.1 NZ_LT969521:c124070-123720 [Pseudomonas aeruginosa]
MSKRLQHQFDRGDIVSLDMGSASAQAACKALVLSPAAYNVLGLALAIPITEHDSSRYAGFAVAILLPGRTPAKGAALVNL
VRPVDLAARGAKLLGKAPQTTIDEALQRLQAVVGKD

Download         Length: 351 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8738.98 Da        Isoelectric Point: 4.1093

>AT293955 WP_023100677.1 NZ_LT969521:c124315-124067 [Pseudomonas aeruginosa]
MKTTIRAIGNSQGITIPKPLLAELGVSLGDPVDVSFKDQTLVVTKVATEYDLSTLVAQCDLEAPEPPDIQCWRTATPVGN
EA

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K4Y2Z0

Antitoxin

Source ID Structure
AlphaFold DB A0A2K4Y2Y6

References