Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
| Location | 121212..121743 | Replicon | plasmid RW109 plasmid 2 |
| Accession | NZ_LT969521 | ||
| Organism | Pseudomonas aeruginosa isolate RW109 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2K4Y311 |
| Locus tag | RW109_RS37930 | Protein ID | WP_023100672.1 |
| Coordinates | 121462..121743 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | W2D9V6 |
| Locus tag | RW109_RS37925 | Protein ID | WP_020303033.1 |
| Coordinates | 121212..121475 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RW109_RS37905 | 116944..117906 | - | 963 | WP_004577240.1 | IS30-like element ISPpu17 family transposase | - |
| RW109_RS37910 | 118561..120117 | - | 1557 | WP_019818069.1 | IS66 family transposase | - |
| RW109_RS37915 | 120199..120534 | - | 336 | WP_019719038.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| RW109_RS37920 | 120531..120899 | - | 369 | WP_078451037.1 | IS66 family insertion sequence hypothetical protein | - |
| RW109_RS37925 | 121212..121475 | + | 264 | WP_020303033.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| RW109_RS37930 | 121462..121743 | + | 282 | WP_023100672.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| RW109_RS37935 | 121780..122115 | + | 336 | WP_023100673.1 | hypothetical protein | - |
| RW109_RS37945 | 122497..122949 | + | 453 | WP_023100674.1 | hypothetical protein | - |
| RW109_RS37950 | 122998..123720 | - | 723 | WP_031634065.1 | hypothetical protein | - |
| RW109_RS37955 | 123720..124070 | - | 351 | WP_023100676.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| RW109_RS37960 | 124067..124315 | - | 249 | WP_023100677.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| RW109_RS38330 | 124312..124731 | - | 420 | WP_041167413.1 | hypothetical protein | - |
| RW109_RS37965 | 124851..125327 | - | 477 | WP_023100690.1 | single-stranded DNA-binding protein | - |
| RW109_RS37970 | 125338..125775 | - | 438 | WP_023100689.1 | hypothetical protein | - |
| RW109_RS37975 | 125784..126467 | - | 684 | WP_023100688.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..151612 | 151612 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10724.19 Da Isoelectric Point: 9.0277
>T293954 WP_023100672.1 NZ_LT969521:121462-121743 [Pseudomonas aeruginosa]
MRTIEQTSRFKRDYKREAKGPHRQTLASDFVAIVTALANDQPLAEKHRDHALNGDWKDHRDCHIKPDLVLIYRKPDDAVL
QLVRLGSHSELGL
MRTIEQTSRFKRDYKREAKGPHRQTLASDFVAIVTALANDQPLAEKHRDHALNGDWKDHRDCHIKPDLVLIYRKPDDAVL
QLVRLGSHSELGL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K4Y311 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0W0N2R7 |