Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 7014326..7015019 | Replicon | chromosome |
Accession | NZ_LT969520 | ||
Organism | Pseudomonas aeruginosa isolate RW109 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | RW109_RS37090 | Protein ID | WP_003151133.1 |
Coordinates | 7014642..7015019 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | RW109_RS37085 | Protein ID | WP_001172026.1 |
Coordinates | 7014326..7014661 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RW109_RS37050 | 7009951..7010964 | + | 1014 | Protein_6560 | transposase | - |
RW109_RS37055 | 7011253..7012047 | + | 795 | WP_008328897.1 | hydratase | - |
RW109_RS37060 | 7012355..7012618 | - | 264 | Protein_6562 | transposase | - |
RW109_RS37065 | 7012763..7013218 | + | 456 | Protein_6563 | DUF4158 domain-containing protein | - |
RW109_RS37070 | 7013258..7013629 | - | 372 | WP_023103794.1 | hypothetical protein | - |
RW109_RS37075 | 7013626..7013952 | - | 327 | WP_000091614.1 | hypothetical protein | - |
RW109_RS37080 | 7013976..7014311 | - | 336 | WP_000741275.1 | hypothetical protein | - |
RW109_RS37085 | 7014326..7014661 | - | 336 | WP_001172026.1 | helix-turn-helix domain-containing protein | Antitoxin |
RW109_RS37090 | 7014642..7015019 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
RW109_RS37095 | 7015211..7015813 | + | 603 | WP_010465829.1 | recombinase family protein | - |
RW109_RS37100 | 7015797..7018826 | + | 3030 | WP_057384098.1 | Tn3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 6991120..7015813 | 24693 | |
- | inside | IScluster/Tn | - | - | 6991120..7018826 | 27706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T293953 WP_003151133.1 NZ_LT969520:c7015019-7014642 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |