Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 6973607..6974300 | Replicon | chromosome |
Accession | NZ_LT969520 | ||
Organism | Pseudomonas aeruginosa isolate RW109 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | RW109_RS36840 | Protein ID | WP_003151133.1 |
Coordinates | 6973607..6973984 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | RW109_RS36845 | Protein ID | WP_001172026.1 |
Coordinates | 6973965..6974300 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RW109_RS36830 | 6969800..6972829 | - | 3030 | WP_057384098.1 | Tn3 family transposase | - |
RW109_RS36835 | 6972813..6973415 | - | 603 | WP_010465829.1 | recombinase family protein | - |
RW109_RS36840 | 6973607..6973984 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
RW109_RS36845 | 6973965..6974300 | + | 336 | WP_001172026.1 | helix-turn-helix domain-containing protein | Antitoxin |
RW109_RS36850 | 6974315..6974650 | + | 336 | WP_000741275.1 | hypothetical protein | - |
RW109_RS36855 | 6974674..6975000 | + | 327 | WP_000091614.1 | hypothetical protein | - |
RW109_RS36860 | 6974997..6975368 | + | 372 | WP_023103794.1 | hypothetical protein | - |
RW109_RS36865 | 6975408..6976022 | + | 615 | Protein_6523 | FAD-dependent oxidoreductase | - |
RW109_RS36870 | 6976040..6976405 | + | 366 | WP_000995360.1 | mercury resistance co-regulator MerD | - |
RW109_RS36875 | 6976402..6976638 | + | 237 | WP_003132004.1 | broad-spectrum mercury transporter MerE | - |
RW109_RS36880 | 6976635..6977624 | + | 990 | WP_003132006.1 | DUF3330 domain-containing protein | - |
RW109_RS36885 | 6978240..6979166 | - | 927 | WP_047219935.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T293952 WP_003151133.1 NZ_LT969520:6973607-6973984 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |