Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5754335..5754921 | Replicon | chromosome |
Accession | NZ_LT969520 | ||
Organism | Pseudomonas aeruginosa isolate RW109 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | RW109_RS31140 | Protein ID | WP_003120987.1 |
Coordinates | 5754622..5754921 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | RW109_RS31135 | Protein ID | WP_003448662.1 |
Coordinates | 5754335..5754625 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RW109_RS31120 | 5749917..5751806 | + | 1890 | WP_101476551.1 | hypothetical protein | - |
RW109_RS31125 | 5751803..5753779 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
RW109_RS31130 | 5753920..5754264 | + | 345 | WP_016851612.1 | hypothetical protein | - |
RW109_RS31135 | 5754335..5754625 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
RW109_RS31140 | 5754622..5754921 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
RW109_RS31145 | 5755123..5756247 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
RW109_RS31150 | 5756247..5757956 | + | 1710 | WP_023125172.1 | PilN family type IVB pilus formation outer membrane protein | - |
RW109_RS31155 | 5757960..5759285 | + | 1326 | WP_003120992.1 | type 4b pilus protein PilO2 | - |
RW109_RS31160 | 5759275..5759808 | + | 534 | WP_003120993.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5742949..5817887 | 74938 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T293950 WP_003120987.1 NZ_LT969520:c5754921-5754622 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|